CAZyme Information: MGYG000001422_01265

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01265
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000001422_1|CGC20	37088.52	9.2419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1389705; End: 1390685 Strand: +

Full Sequence      

MKKNSIHILIVSSVALCVGTALPFLLGHSAIDPEQQSVKSEVPYCVTSPAVPDRITFAGQ
EIDLKRYDHRERMDREQMSFTYMHSTTMLTIKRANRFFPIIEPILKENGVPDDFKYLAVI
ESNLNTLARSPAGAAGMWQFMQTTGREFGLEVNPSVDERYHVEKATHAACKYLKDAYQRY
GNWLCVAAAYNGGQGRISSELRKQLVDQAVDLWLVEETSRYMFRLLAAKAVISNPQRYGF
LLKREHLYPPIPYTEVTINTGIDNLAQFAKDKGITYAQLKDANPWLRDSSLQNKSGRTYV
LKIPTQAGMHYDPKKTVPYNKNWVIN

Enzyme Prediction     

No EC number prediction in MGYG000001422_01265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	98	233	2e-23	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	9.60e-65	105	229	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	5.97e-28	100	197	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	1.40e-22	56	284	64	293	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	9.32e-18	117	228	5	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.58e-13	113	197	11	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69567.1	2.80e-229	1	326	1	326
ALJ61767.1	2.68e-227	1	326	1	326
QUT92673.1	5.41e-227	1	326	1	326
QUT60528.1	6.33e-210	1	326	1	326
QUT66947.1	6.33e-210	1	326	1	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.21e-23	53	301	58	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.21e-23	53	301	58	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.813365	0.175038	0.008678	0.000480	0.000295	0.002150

TMHMM  Annotations     

start	end
5	27