CAZyme Information: MGYG000001420_00599

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_00599
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000001420_1|CGC11	89581.02	5.7695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 773918; End: 776290 Strand: -

Full Sequence      

MLLICAALLAGAVCTTAPAQEVPDLKGGPMGVERIAKLANYSVYSSVPADSPTDTCWMQV
DLGRSYPIDQVKLYPVIWDWWLAVWRPRFPVRFKLEAADNEAFDNPRLISDQTAKDYEVT
IVDKVDSYAPSEPVSGRYVRLTVTKLPEFQKKYSFDLWRFEVISGGKDIAEGRTLSDSGR
GYLGKHQLLRAPRPMGELAVLDCPENVTSPDSWRPVKAELRVPHKGVRVGGLFGKVMDRN
AHYLLTSFTVNDMLRDFRIRAGKPVSEKKDRDIDIEWLKYLPGSVAGRFLMGTGNQLRWK
DDPELRKRMNQIVDGIEECAEPNGYLVGYPENEILVFEYGGYCRSWVSQGLLEAAIAGNT
KAYPMLRKFYDWFNTCPYLPELVRRGAFGRQGIIPSTRLYHTPVGKPLDIQVAQRYYQEN
FWMDQLADRDVDAIWKIPYDRPHCYLIVTLNAYMDMYMATGEERYLEAVLGGWDIYHDYF
QHTGGSISICEKLEYPPKSYLLRLGTGELCGNSFWSFLNQQLHAVFPDEEKYANEIEKSI
YNVGIANQTQDGSIIYHAMLVGHKNRGENHNTCCEGQGTRWFGALPEFIYSIADDGIYVN
LFNESTIEWTQSDGNEMSVRMQTAFPENPEVKLTVSPGNGKAYSNIRLRVPQWADAPMEV
TVNGKRVGTGRPGSYLALKRTWKKGDVIAFTLPIGFRLTKYNGTAEGFKGTEAYALEYGP
LLMAAMSPSEEKGFLDIPVAPSELPSRLKPENNDPLRFKVECSEAGIEYVPYYRIADENF
TCYPFLKKAE

Enzyme Prediction     

No EC number prediction in MGYG000001420_00599.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	232	724	7.5e-56	0.9840954274353877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.76e-62	227	724	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.18e-31	205	725	1	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam00754	F5_F8_type_C	7.11e-05	49	145	28	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23996.1	0.0	21	790	24	808
AXC12824.1	1.66e-232	16	788	34	821
VEH16333.1	4.20e-125	197	790	324	922
QEH33835.1	2.23e-34	209	759	15	569
ADY54289.1	5.92e-34	237	790	61	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.95e-21	527	730	364	566	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.35e-20	527	730	364	566	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	7.15e-20	455	728	260	549	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.18e-19	254	722	55	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.25e-17	254	722	55	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000298	0.999097	0.000148	0.000172	0.000142	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_00599.