CAZyme Information: MGYG000001416_01685

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_01685
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1005	MGYG000001416_1|CGC25	108349.21	4.6542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 1808446; End: 1811463 Strand: +

Full Sequence      

MRTTTTRRWALPVVASLALVGLVPTTASGAEELPFRDPDLPLQVRIDDLLSRLTQDETLS
LLHQFPLPVPRLGIEHFRTGTEALHGLAWTTSYEDGAVHTATATTFPQAVGLASTWDADL
VERVGDVVSDEARGYHAQDPQLWGLNLWAPVVNLLRDPRWGRNEEGYSEDPLLTGAMATA
YGTGLVGEDDTYLKTAPTLKHYAAYNTETKRDTANSSVPPRVLHEYDLPVFEAPIRADAA
TGVMASYNLINGRPATVDPTLDTLVRSWSDRTLLNVSDANAPNNLVQSQDYFDTLAEADA
AAVKAGLDSMTVNDNDPWPTIHAFQEALDRGLITQAEIEDAASHVLSIRFRLGEFDPDGG
PYGDIGADAVDTPAARALARETAADAMVLLKNDGAKGRTHGAPSALLPLSTSTTRTAAVI
GPLADTLYTDWYGGALPYRVTVRDGVAERLGASRVTGSEGVDRIALRDVASGRYVTGGTG
EAGGPLTAAGSSADDPAAQLDVFDWGSGVVTLRSAANGRYVGLAGTGFANDQTQPNGWFV
QQQFRLEDVGDGQVALRYAGYEAAYDWAPSHRTPYLTVAADGSLVLGAQTAADAAHFDRE
VVRDGVAEAVAAAKEADTAVLVVGSMPFINGREDHDRTSLALAEGQEELVRAVVAANPRT
VVVLQTSYPDTITWLQQHVPAIVWTTHAGQETGHAVADVLFGDVNPAGRLTQTWPRSEAD
LPDDLLDYDIVSSGQTYLYDDTDPLYAFGHGLSYTSFRYSRLKVADSRLSATDTLRVSVD
VTNTGRRAGDEVVQLYTHQRSSRVEQPIQELQAFDRVHLRPGQTRTVRFEVPVSQLATWD
VTRSRWVVEPSVHDVLVGAASDDVRQRASVKVAGEAIPPRDLSRTTEAQNLDDSRAVTFV
DTTKAEGTSVEGGAGSWLAFEDVDLRRGARTFTAWVAKADAGQGRIEVRLGSPRGRLVGT
ATVSSTGDRYAYATVRADLRRVSGVQDVYLVLDSTQRVHTVRLTR

Enzyme Prediction     

EC	3.2.1.120	3.2.1.74

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	310	1.6e-52	0.9722222222222222
CBM6	886	1001	3e-20	0.8478260869565217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.74e-95	17	866	4	759	beta-glucosidase BglX.
PLN03080	PLN03080	1.03e-69	24	831	31	742	Probable beta-xylosidase; Provisional
COG1472	BglX	1.04e-46	70	448	56	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	4.41e-41	387	754	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.99e-31	87	348	68	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM08953.1	0.0	1	1005	1	1018
QFU97444.1	0.0	1	1005	1	1026
ASW53890.1	0.0	1	998	1	988
SCG36972.1	0.0	1	998	1	988
SCE65879.1	0.0	7	998	2	988

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TF0_A	1.68e-65	69	865	71	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z9S_A	1.81e-65	25	861	7	775	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
4I3G_A	7.15e-65	4	872	16	828	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5XXL_A	1.67e-64	43	865	42	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	7.75e-64	43	865	42	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27034	8.72e-84	46	870	2	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q94KD8	1.73e-75	25	869	34	761	Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=BXL2 PE=2 SV=1
D5EY15	1.90e-73	16	863	8	851	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
T2KMH0	2.75e-69	39	865	30	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.45e-68	104	866	118	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000502	0.998551	0.000241	0.000264	0.000219	0.000184

TMHMM  Annotations     

start	end
9	28