CAZyme Information: MGYG000001416_00195

Basic Information

• Species: Cellulomonas massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas massiliensis
• CAZyme ID: MGYG000001416_00195
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001416_1|CGC3	40280.32	10.5067

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001416	3245988	Isolate	not provided	not provided

• Gene Location: Start: 221821; End: 222948 Strand: +

Full Sequence      

MTPPPSAPPAAGGRARLYRTARTAHLERAATLPPALLLFDEARYDFDPELARRVGAVQVG
ALGAARLVGRAGVTTLEVNEPALLDGARRTAVTLAWLGLRALLGRARPVVVTYAIDNLDP
RDVREPGLRRRLARRVDLALARFVWSRCDRVAFGTPAAERMYAQAFPRHRRPLRTTVVPA
LPEPCGCVGDEPRAGAVFLGAFADRKGLPLLAAAWPHVARELPGARLTLVGKGPLEPLAR
ELAQRADVDLLVDPPRDRIHAVLRSAQVLVLPSRRTARWREQVGLPIVEGLAHGCTVVTT
SETGLADWLDAHGHHVVPDDGRAETVAEALAAALRTVRDPASVRADLPTADGRLAADAWM
FADGDRAQPMGSGTA

Enzyme Prediction     

No EC number prediction in MGYG000001416_00195.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	196	334	8.6e-20	0.85625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.26e-20	95	335	94	332	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.54e-20	79	334	82	340	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13692	Glyco_trans_1_4	3.92e-17	197	337	5	135	Glycosyl transferases group 1.
cd03798	GT4_WlbH-like	7.75e-15	139	334	142	340	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
pfam00534	Glycos_transf_1	3.96e-14	197	334	6	142	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV80741.1	2.96e-109	14	361	21	369
QVI66603.1	3.60e-106	1	361	1	371
VEH35447.1	1.27e-105	14	361	15	366
AEE47161.1	1.27e-105	14	361	15	366
ANF31692.1	1.48e-105	14	361	8	356

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001416_00195.