CAZyme Information: MGYG000001409_00490

Basic Information

• Species: Slackia_A piriformis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Slackia_A; Slackia_A piriformis
• CAZyme ID: MGYG000001409_00490
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	MGYG000001409_1|CGC3	28255.05	4.5479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001409	2100463	Isolate	not provided	Asia

• Gene Location: Start: 559043; End: 559816 Strand: -

Full Sequence      

MRRAAYTNDISKPPIVLRVLGSIVKWTLIALLAGLVAAAAYFVVRGYALYNNAAQEKSVA
DMVTDIESRAGFTPLEELPETYLAAVVSVEDHRFYQHPGFDALATSRALFNDLRAGAIVE
GGSTITQQLAKNEFFSQEQVVERKIAEVFMAFDIERALDKDRILELYVNSIYFGEGLYGI
GPACQGYLGKAPGTMNDWESTMLAGTPNAPSVYAPTVNYDLACQRQQQVLEQMVKYHAIT
QEDANAIAAQANESPWA

Enzyme Prediction     

No EC number prediction in MGYG000001409_00490.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	67	234	6.7e-56	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.53e-73	73	234	16	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.16e-67	69	257	1	185	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	2.14e-63	66	246	63	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	8.27e-58	42	246	54	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.56e-43	74	245	70	241	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK43832.1	7.64e-86	19	250	15	246
CBL03605.1	4.50e-82	38	250	32	244
ACV56467.1	1.37e-81	41	247	35	241
QOS67703.1	1.37e-81	41	247	35	241
APO31194.1	1.37e-81	41	247	35	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.65e-42	72	242	22	192	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	6.54e-42	72	242	22	192	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.27e-35	73	246	40	223	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	6.67e-33	61	252	48	245	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	7.31e-33	61	252	12	209	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KNU5	9.23e-39	75	250	71	246	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
O66874	3.43e-38	72	242	65	235	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O86088	1.05e-37	67	240	65	238	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
O87579	1.44e-37	67	240	65	238	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z5	1.96e-37	67	240	65	238	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000029	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43