CAZyme Information: MGYG000001406.1_02257

Basic Information

• Species: Kurthia massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Kurthia; Kurthia massiliensis
• CAZyme ID: MGYG000001406.1_02257
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000001406.1_5|CGC1	41069.31	9.688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001406.1	3201180	Isolate	not provided	not provided

• Gene Location: Start: 78421; End: 79509 Strand: -

Full Sequence      

MIWVLIPFIWGVVWIIWNAACLPKMKGHTHTASFSILIPLRNESARVDTLMQHLMKIRYP
KVAFLLYDDASTDDTYAKLKSYIAKEPRLTIKQGTQLPEGWRGKPHACQQLSKQATGDIL
LFIDADVVLAPETLYQLDATFTRTKADAISGFARFQNESVLEKLLTPLLHFFIYFHLPII
LANRRQMVAATAASGAFIAVKRTVYEAIGGHAAVKADIVEDVALFRAIKRQRYRAILCHV
ADDVRCAMYGSSKATWRGFQKNCFQAFGESYVFAIGVCLFYSSYFVLPLACAIYSVSTQQ
WIWAVPFLCITLQRCISDVHARQFSLYSLLMPISALIYVALLIYTMIYKKGNKTTYWKGR
AL

Enzyme Prediction     

No EC number prediction in MGYG000001406.1_02257.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	35	206	1.4e-18	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04192	GT_2_like_e	3.23e-23	36	236	1	198	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	6.06e-22	36	210	1	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.49e-18	35	357	57	403	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	6.73e-18	35	205	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06439	CESA_like_1	7.48e-18	6	254	1	234	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMA63522.1	1.07e-119	6	362	5	361
AVK99110.1	5.94e-82	13	361	9	360
AHN21136.1	1.34e-81	13	361	13	364
ALS76007.1	6.17e-80	14	360	15	364
QTL52079.1	1.27e-79	1	360	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	5.02e-07	34	149	3	116	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	6.74e-07	34	149	3	116	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
6YV7_B	2.70e-06	29	128	39	138	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.71e-06	29	128	40	139	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L977	1.60e-08	24	230	34	235	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=crtQ PE=3 SV=1
Q2YWE6	5.02e-07	33	137	40	146	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=crtQ PE=3 SV=1
Q5HCY7	8.91e-07	24	137	32	146	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=crtQ PE=3 SV=2
Q8NUQ4	8.91e-07	24	137	32	146	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=crtQ PE=3 SV=1
Q99R74	8.91e-07	24	137	32	146	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=crtQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.961650	0.034786	0.003132	0.000077	0.000075	0.000308

TMHMM  Annotations     

start	end
4	21
271	293
326	348