CAZyme Information: MGYG000001402_02592

Basic Information

• Species: Coprobacillus cateniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Coprobacillus; Coprobacillus cateniformis
• CAZyme ID: MGYG000001402_02592
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	MGYG000001402_1|CGC42	56707.44	5.0431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001402	3861289	Isolate	not provided	not provided

• Gene Location: Start: 2630403; End: 2631869 Strand: +

Full Sequence      

MKTGFNKDFLWGGAISCSQADGGFLDGGKGISTQDLRYLDPSWNREQVEEKHHKCPFSKA
EFEQALKDMDVTYYPNRRGIDFYHQYKQDIDLFHKMGMKIFRTSICWSRIFPNGDDLMPN
QEGLNYYKDMFAECHKKGIKVFATILHYDIPVNLVLKYGGWKNRQTIQFYVHYAETLFKE
LGDLVDYWLPFNEFNAGRFAPWDGVCLIQDEEENMNQAIFQCLHHQLIANAMTVKLCHEM
LPGVMIGGMIARFETYPATCRPEDALQALQDEQYGNWFYTDVMVRGEYPQYMERYFDMFD
IHINMDIKDSEILKSGLVDFLSFSYYFSQVSTSDQTWEKTAGNLIMANKNPYLNTSEWGW
QMDPIGLRVTLNKMYDRYRLPLMIAENGLGTTDVLESDGTVHDSYRIDYLKSHITQMKEA
VIDGVDIIGYTMWGIIDIVSCGPLTIDKRYGVIYVDLDNGGQGSGKRYCKDSFYWYQKCI
KSNGKELD

Enzyme Prediction     

No EC number prediction in MGYG000001402_02592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	484	3.6e-132	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	5	488	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	2.55e-178	5	488	4	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	6.62e-173	2	488	3	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	1.42e-172	3	487	2	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	5.19e-143	7	487	8	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM12924.1	0.0	1	487	1	487
QOY61128.1	9.02e-276	1	488	2	490
QYN59590.1	3.49e-266	1	485	1	485
QYN52654.1	1.47e-265	1	485	2	486
QUC02549.1	3.72e-263	1	487	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.13e-164	5	487	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.96e-141	3	487	18	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	9.17e-141	5	488	11	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	1.15e-138	7	487	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.26e-138	7	487	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.86e-162	5	487	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	6.21e-155	5	488	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	9.49e-149	5	488	7	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P26206	5.87e-148	1	487	1	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P42973	1.51e-146	7	487	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001402_02592.