CAZyme Information: MGYG000001399_00782

Basic Information

• Species: Odoribacter laneus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter laneus
• CAZyme ID: MGYG000001399_00782
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		46354.36	7.0581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001399	3753471	Isolate	not provided	Asia

• Gene Location: Start: 935212; End: 936408 Strand: +

Full Sequence      

MKKTVVILLLVFLPFLVWSQSKRELEEFARKQEQEREQLKQEQKKGLSDLLAEYEKYVKA
EQEAYAAFKKQVEKEWGKGNAVESTNKDWVEYSDDHKSRTVVDFEKGEAKIEIIVGENEV
QDTGELKRKLEEEVTRLMENRGTSKDYDTEYEKRRQLSEEPVLAGQVETPEGGKISKENL
PEAVKEIVEKGEPKIEKVKGEDGEEREVVVFSLPLAPDHIRVRAKRYETEVENFCRKYSF
DPALVYAVIHTESYFNPKAKSYVPAYGLMQIVPHYAGKDAYRYVYGKDKRPTANYLYEPH
NNVELGTAYLHLLYTRSFQQVKDSKSRMLCVIAAYNTGAGNVSRAFTGNTRLSNAISKIN
SYSYEDLYAYLSKRLPAQETRDYIRKVTERMQQYKEWR

Enzyme Prediction     

No EC number prediction in MGYG000001399_00782.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	240	394	3e-23	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	4.59e-82	231	392	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.43e-56	68	395	44	357	membrane-bound lytic murein transglycosylase MltC.
cd16896	LT_Slt70-like	6.76e-31	225	387	2	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.23e-30	227	395	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	5.75e-25	237	346	7	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQD25248.1	2.68e-63	1	395	2	368
QQD22621.1	1.48e-62	1	395	2	368
ACO04855.1	7.44e-59	84	391	79	389
QQM65924.1	2.03e-57	16	394	24	398
QCU76567.1	2.03e-57	16	394	24	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.68e-38	68	395	26	339	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	4.53e-38	68	395	26	339	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	2.69e-18	241	389	36	181	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	5.06e-18	241	389	36	181	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	6.12e-18	241	389	53	198	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZM39	1.77e-41	68	395	45	358	Membrane-bound lytic murein transglycosylase C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=mltC PE=3 SV=2
A9N4R0	1.77e-41	68	395	45	358	Membrane-bound lytic murein transglycosylase C OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=mltC PE=3 SV=2
Q5PMM0	1.77e-41	68	395	45	358	Membrane-bound lytic murein transglycosylase C OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=mltC PE=3 SV=2
Q8Z3T9	2.47e-41	68	395	45	358	Membrane-bound lytic murein transglycosylase C OS=Salmonella typhi OX=90370 GN=mltC PE=3 SV=2
A9MQR3	3.44e-41	68	395	45	358	Membrane-bound lytic murein transglycosylase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000486	0.997849	0.001081	0.000188	0.000178	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001399_00782.