CAZyme Information: MGYG000001398_01915

Basic Information

• Species: Longicatena caecimuris
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Longicatena; Longicatena caecimuris
• CAZyme ID: MGYG000001398_01915
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000001398_1|CGC17	55403.76	5.3253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001398	3065798	Isolate	not provided	not provided

• Gene Location: Start: 2095238; End: 2096671 Strand: -

Full Sequence      

MKRKITGFPKDFLWGGAIAANQAEGAWNIDGKGPSMADIEILPEQYDRHKVVGFAHTAKQ
IEEALADTKGYYPRRHGIDFYHTYKEDLALMKEMGFTCFRTSFNWTRIFPHGDEEQPNEE
GLKFYDDLLDEMLKNGIEPIMTVSHYEMPIHLITKYKGWYAPEMIDFFVKYCNVLFERYH
NKVRYWILLNQINSLQGWGEFASLGMVQDGYEDWESAKYQATHHQFVACAKATQLAHALD
PSLQIGMMLGDDALYPASCKPEDVFANTQQMQMSLYFYSDVLLRGEYPGYALRYFYDHDI
HVMIKEEEEQLLKENTADFLSFSYYFTRITKAKDPTHPKENPYLEKSIWGWAVDPLGFRN
SLNLYWDRYQIPIFIAENGLGALDEVVDGKVHDPYRIAYLQAHIAAMKEAIKDGVQVFGY
ASWGPIDIISCSQGEMSKRYGYIYVDLDDRGHGSGKRLRKDSFYWYQHVIMTNGEDL

Enzyme Prediction     

No EC number prediction in MGYG000001398_01915.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	474	3.4e-138	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	5	477	1	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	8	476	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	3.96e-180	8	477	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	3.64e-172	8	477	6	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	5.17e-164	3	477	2	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT44163.1	0.0	1	477	1	477
QJA04432.1	2.41e-313	1	477	1	476
QIX10756.1	5.65e-312	1	477	1	476
ASU20418.1	3.72e-268	1	477	1	482
ANU71095.1	3.72e-268	1	477	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	8.11e-162	1	477	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	6.91e-158	3	477	4	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.52e-154	5	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.32e-154	5	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	3.69e-150	9	477	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	6.77e-163	8	477	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	6.63e-158	9	477	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	3.79e-157	3	477	4	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	5.58e-153	8	477	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P24240	6.30e-152	8	477	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001398_01915.