CAZyme Information: MGYG000001396_02339

Basic Information

• Species: Clostridium_AQ innocuum
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ innocuum
• CAZyme ID: MGYG000001396_02339
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000001396_2|CGC7	34528.24	9.9633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001396	4835467	Isolate	not provided	not provided

• Gene Location: Start: 945154; End: 946107 Strand: +

Full Sequence      

MAYTNSNLISYTKLSPNHSGQRTHSIDRITPHCVVGQLSAESICGCFTSPSRQASCNYGI
GKDGRISLCVEEKNRSWCSSSNANDQRAVTIECASDMSEPYAMNSAVYNSLIKLCVDVCR
RNGKMKLLWLADKNKTLNYAPKSDEMVLTVHRWFANKSCPGNWLYSRLGDLAAKVTSELS
KTTSGGGTASTSQMYRVRKTWSDSKSQLGAYKMLANAKKKADENAGYKVFDASGNIVYPT
AAKPTKTPAANTSYKVQIDIANLNIRKGPGTNYGKTGQFTGKGIFTIVQESKGEGATLWG
KLKSGAGWISLDFAKKI

Enzyme Prediction     

No EC number prediction in MGYG000001396_02339.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01510	Amidase_2	8.21e-18	26	162	2	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
cd06583	PGRP	7.51e-07	52	163	34	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
smart00644	Ami_2	3.90e-04	47	160	26	126	Ami_2 domain.
COG3023	AmpD	0.002	48	121	60	141	N-acetyl-anhydromuramyl-L-alanine amidase AmpD [Cell wall/membrane/envelope biogenesis].
pfam08239	SH3_3	0.004	261	313	1	52	Bacterial SH3 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22979.1	5.48e-113	1	311	184	441
AFB75734.1	1.10e-112	1	311	184	441
CBL18646.1	4.65e-106	1	317	3	505
ADB89215.1	9.03e-96	1	312	11	440
AFB76124.1	9.18e-57	4	179	7	179

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999949	0.000058	0.000013	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001396_02339.