CAZyme Information: MGYG000001394_03462

Basic Information

• Species: Yokenella regensburgei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yokenella; Yokenella regensburgei
• CAZyme ID: MGYG000001394_03462
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157	MGYG000001394_16|CGC22	17280.56	7.1617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001394	4680112	Isolate	not provided	not provided

• Gene Location: Start: 1560848; End: 1561321 Strand: -

Full Sequence      

MTQQSAIIPLLRQEEGVRYTPYLDSLGYPTTGVGFKLGPQGASIKNYTFRLSDTTIDAWL
SDTVSGVQAGMRKNSEISIALAHCNQPRQDILTSMAYQMGVVGLSGFHQMLTAISAEEWD
EAVAQMLNSSWAKQTPSRAQRQSAVLKSGLWQPTYSF

Enzyme Prediction     

No EC number prediction in MGYG000001394_03462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	6	135	1.9e-20	0.8686131386861314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	2.05e-73	7	153	2	146	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	5.84e-30	7	149	175	331	baseplate hub subunit and tail lysozyme; Provisional
cd00737	lyz_endolysin_autolysin	1.70e-10	8	132	2	116	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	4.54e-07	5	133	9	128	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	1.54e-06	5	133	6	121	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU89084.1	2.70e-109	1	157	1	157
ATG02899.1	1.31e-75	1	155	1	155
VDZ91101.1	1.31e-75	1	155	1	155
QHA89550.1	9.48e-64	4	157	2	155
QKT18705.1	3.51e-60	1	157	1	157

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RGR_A	2.95e-19	10	151	10	162	ChainA, Artificial protein L056 [synthetic construct],7RGR_B Chain B, Artificial protein L056 [synthetic construct]
2B7X_A	1.21e-18	7	151	3	164	ChainA, Lysozyme [Tequatrovirus T4],2B7X_B Chain B, Lysozyme [Tequatrovirus T4],2B7X_C Chain C, Lysozyme [Tequatrovirus T4],2B7X_D Chain D, Lysozyme [Tequatrovirus T4]
1G0L_A	4.49e-17	7	151	3	158	ChainA, PROTEIN (LYSOZYME) [Tequatrovirus T4]
1PQM_A	6.31e-17	7	151	3	158	ChainA, Lysozyme [Tequatrovirus T4]
1G0M_A	6.31e-17	7	151	3	158	ChainA, PROTEIN (LYSOZYME) [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16009	8.00e-15	10	149	179	334	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2
Q556F2	6.97e-12	5	149	3	164	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
Q86AA1	5.32e-10	5	149	3	164	Probable T4-type lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274291 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001394_03462.