CAZyme Information: MGYG000001390_00608

Basic Information

• Species: Bacillus_O smithii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Domibacillaceae; Bacillus_O; Bacillus_O smithii
• CAZyme ID: MGYG000001390_00608
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	MGYG000001390_5|CGC1	22121.38	9.2713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001390	3224201	Isolate	not provided	not provided

• Gene Location: Start: 163959; End: 164552 Strand: -

Full Sequence      

MNWVTSTVMKKAFIWFLFPFIILVGFVTYKWTNGKIEENVSIPKEYIPIYKAAAQKYGVP
WELLAAHHRVETKFSKGPLVSPAGAEGPMQFMPCTFVGWKYPGCEGKGKGKIPEKDKTNP
AVIKKYGGYGVDANGDGKADPFDLEDAVFSAANYLARNGAANGHWKKAVYAYNHSEQYVE
EVLFYTNKYKMTESTSF

Enzyme Prediction     

No EC number prediction in MGYG000001390_00608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	59	192	6e-21	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	8.54e-35	57	183	1	103	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	8.51e-15	5	177	81	261	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	4.82e-11	51	173	2	93	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
pfam13406	SLT_2	1.23e-10	44	167	71	203	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
cd00254	LT-like	3.51e-08	62	173	2	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKP47212.1	1.27e-147	1	197	1	197
QTD43298.1	1.06e-81	42	190	54	203
BCB03772.1	1.56e-79	41	189	25	174
QWC24936.1	3.03e-79	41	189	29	178
VEF48095.1	4.50e-79	33	194	47	209

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999085	0.000587	0.000230	0.000003	0.000002	0.000127

TMHMM  Annotations     

start	end
12	29