CAZyme Information: MGYG000001380_03039

Basic Information

• Species: Ruminococcus_B gnavus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_B; Ruminococcus_B gnavus
• CAZyme ID: MGYG000001380_03039
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	MGYG000001380_13|CGC1	22608.57	5.648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001380	3437962	Isolate	not provided	not provided

• Gene Location: Start: 9329; End: 9922 Strand: -

Full Sequence      

MKEKTRQCRYVRPIAHDLLSEKEKTKAASELAKMIERNENHLNTGFLTTHELSRSLSQYG
QNRKAYDLLLQEEKPGWLFAVTKGCTTIPESWDCYDEEGNPHDSFNHYSYGAVAGWLMDC
VCGINVSDGKIVIQPYPDERLRFAAAAYDSPYGKIVSEWKYEEGKVKYHVEIPTNMCAEI
LIDGREKMRVEAGVYEL

Enzyme Prediction     

No EC number prediction in MGYG000001380_03039.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	5	180	1.8e-50	0.3531746031746032

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.26e-29	10	121	229	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.08e-16	130	196	11	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30263.1	7.21e-141	1	197	411	607
ADL34423.1	2.81e-56	6	197	560	753
QTE67956.1	9.45e-52	6	195	560	747
AHF25957.1	2.06e-51	6	176	641	811
QQD65395.1	2.76e-50	6	197	689	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	9.35e-25	7	191	812	1003	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	7.49e-31	7	191	696	889	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	5.11e-24	7	191	812	1003	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.93e-12	34	186	753	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001380_03039.