CAZyme Information: MGYG000001380_02125

Basic Information

• Species: Ruminococcus_B gnavus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_B; Ruminococcus_B gnavus
• CAZyme ID: MGYG000001380_02125
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000001380_7|CGC1	50246.98	5.2429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001380	3437962	Isolate	not provided	not provided

• Gene Location: Start: 23381; End: 24685 Strand: -

Full Sequence      

MSRVTVSEDKSTFCRDKKPFFYLADTIWSAFTNITEDEWIYYLKRRKEQGFNVLQINTMP
QWDRCISDIGLYPFATADGHRFDFTKWNEAYYEHAVRMCELAEEEGFQLALVVLWLNYVP
GTWGSKVTDCNVMPKEFVKTYTEKIVHVFDRFEPIYIVSGDTDFDTPEAVSYYRDALDVL
CEKSPHTLKTMHIKRGYDFLPEEFLEKLDFYMFQSGHNREGQDMAYVLPENFRKKYPKKP
LINAEPCYEQMGFSRKIYGRFQAEDTRKAAWSSILSGACAGVAYGAHGIWNWQKLNKPAN
PILGEGFDAPFPWNEALQFPGAWDYGMIRQLLDELHTGELIPAQEVLENETTQIRMAQTT
DGRYLLYLPHSTKVVLNRELNGCSVRAVDLASGHRAYVSAVCREGKTEIAMHPFYYDALL
VVEADKTDVEKGRD

Enzyme Prediction     

No EC number prediction in MGYG000001380_02125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	4	384	5.6e-103	0.9053398058252428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.45e-97	16	335	9	320	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT29801.1	0.0	1	434	1	434
QEI31005.1	0.0	1	413	1	413
QHB23513.1	0.0	1	413	1	413
AJH02030.1	1.24e-155	1	422	1	424
AQR97273.1	1.69e-154	1	422	1	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	5.52e-23	19	431	34	454	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.61e-20	19	431	34	454	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.53e-16	19	371	47	403	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000093	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001380_02125.