CAZyme Information: MGYG000001380_00571

Basic Information

• Species: Ruminococcus_B gnavus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_B; Ruminococcus_B gnavus
• CAZyme ID: MGYG000001380_00571
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000001380_2|CGC5	45413.18	5.1565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001380	3437962	Isolate	not provided	not provided

• Gene Location: Start: 175098; End: 176282 Strand: -

Full Sequence      

MKYELGISVYPDLRPLEEIEAYFELASRYSVSKVFSSMFSVEGTKEEVLEYFRKLIAAAH
RNNLKVSLDVNPMCFEKMGATPDDLSVFKSIEVDCLRMDLSYGAENDAKLVRNPYGIKIE
FNNSPDIVNGLIACGIDPKDFSVCHNFYPQRYTGMKWEKFVQKNAELKSVSRHVRIGAFI
SSTAKNTHGVWNAVYGLPTVEKLRMLPIDLQARMMLATGNIDELLVGNAYATEEELKKLY
EVLKESSKIQNDLDPTLKMLIEHGIISLDKPVKRLRVILDQNITEKEKEVLFDFFPHLEM
GDSSEWIWRTRISRFKYSQPKEVITPRKVNGEMFEVGDVVIVNDNYKHYAGEIQIVKIPI
VNDGTRNRIGHLDEDEYQMMEFIYDGELVEFLEK

Enzyme Prediction     

No EC number prediction in MGYG000001380_00571.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	4	248	3.4e-68	0.68

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	3.16e-77	5	239	1	233	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	1.98e-69	4	394	3	359	Uncharacterized protein [Function unknown].
pfam05913	DUF871	1.41e-19	275	386	3	110	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
PRK09441	PRK09441	7.07e-04	43	118	78	136	cytoplasmic alpha-amylase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30117.1	5.36e-291	1	394	1	394
AMK55490.1	2.70e-92	2	393	17	408
BBH25090.1	8.04e-89	3	386	2	356
QIX07901.1	1.41e-83	3	381	2	350
QNM14116.1	7.93e-83	3	381	2	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	2.24e-62	1	383	25	375	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001380_00571.