CAZyme Information: MGYG000001378_02214

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_02214
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001378_4|CGC1	44292.41	6.6006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 21167; End: 22309 Strand: -

Full Sequence      

MKKPLFLLFTGLLLSCLIPVHTVAAQELPTQKETLENIIKVNDYFMKKYADYTTPSFYGR
VRPSNIWTRGVYYEGLMALYSIYPREDYYKYTYDWADFHKWGMRNGNTTRNADDHCCGQA
YIDIYKICPSDPNMIRNIKASIDMVVNTPQVNDWWWIDAVQMAMPIFAKFGKMTGEQKYY
DKMWDMYYYTRSQHDETGMFNPKDGLWWRDQDFNPPYKEPNGEDCYWSRGNGWVYAALVR
VLDEIPSDEKHRQDYINDFLTMSKALKKCQREDGFWNVSLHDPTNFGGKETSGTALFVYG
MAWGVRNGLLDRKEYLPVLLKAWNAMVKDAVHPNGFLGYVQGTGKEPKDGQPVTYKSVPD
FEDYGVGCFLLAGTEVYKLK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	378	2.5e-94	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.02e-119	37	380	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.34e-54	45	379	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL41144.1	1.96e-304	1	380	1	380
ALJ49013.1	7.97e-304	1	380	1	380
QRQ55821.1	7.97e-304	1	380	1	380
QUT83154.1	7.97e-304	1	380	1	380
SCV08431.1	7.97e-304	1	380	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	4.49e-71	1	375	1	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	6.20e-65	30	375	12	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.92e-49	154	380	152	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.47e-16	21	379	6	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.50e-15	63	379	25	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	1.90e-52	67	380	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.24e-48	154	380	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	6.82e-36	111	376	135	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.45e-15	21	379	6	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000489	0.910427	0.088215	0.000305	0.000287	0.000249

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_02214.