CAZyme Information: MGYG000001378_00175

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_00175
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000001378_1|CGC6	43330.89	7.9412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 252236; End: 253348 Strand: -

Full Sequence      

MKRNYLIYALLMTVFLSSNVISAQNCFGDFPVKADPKTVGNKLSRRLMETKHQLYFDRGI
HYAEVCTWYGALRFAELTNNKELIKLLRNRFELLFHLEKELLPPPIHVDQNMFGCLPLRF
YNITKDKRYLDLGLPYADTQWELPANANEEERKWDKKGYSWQTRLWIDDMYMITIVQSEA
YKATGDPKYINRAAKEMVLYLDELQHPNGLFYHAPDVPYYWGRGDGWMAVGMTELLYNLP
EKDPNRARIMKGYLLMMDNLKKYVNKDGLWNQLITEPDFWTETSGSAMFTYAMIVGVNNG
WLDKEEYAPVARRAWLGLCNYINDKNDLTEVCVGTGKKNSKQYYMDRPRIAGDYHGQAPI
IWCAYALLNK

Enzyme Prediction     

No EC number prediction in MGYG000001378_00175.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	367	5.4e-73	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.41e-51	67	365	34	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.37e-43	61	361	35	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG1331	YyaL	0.006	178	224	283	329	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72409.1	1.92e-290	1	370	1	370
QRQ54522.1	3.05e-287	1	370	1	370
ALJ47613.1	3.05e-287	1	370	1	370
SCV07012.1	3.05e-287	1	370	1	370
QUT26150.1	1.98e-283	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	7.98e-29	36	361	13	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
3K11_A	2.04e-28	165	362	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
2GH4_A	3.41e-28	36	361	3	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.88e-22	121	315	128	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.84e-19	166	315	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.37e-28	36	361	13	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	1.85e-17	120	324	124	336	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.85e-17	120	320	122	331	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	7.89e-17	166	324	201	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	1.96e-09	177	366	6	226	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999112	0.000170	0.000151	0.000132	0.000127

TMHMM  Annotations     

start	end
5	27