CAZyme Information: MGYG000001376_02521

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02521
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	MGYG000001376_6|CGC7	89650.29	6.1786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 238165; End: 240516 Strand: -

Full Sequence      

MGNMAASPGNIPLNGRWQLSYWKQPAEAIVTPQAINDMQVETIEATVPGNVELDLMVAGL
IPDPMTGSNVNALRKYENYQWCYTKTFETPSTQNGQRLELFFGGIDCLADIWLNGEKVGE
AANMLIEHKFDITDHLKSGENTLQVIIRSAVMEAQKHTLGTFSIGNFPAEEAVYIRKAPH
MYGWDIMPRLVSAGLWRDVELRVLNPTRLKDVNWMTISIDTAAHTARIFTDVQLIMPFDK
FDKVKVQFTLRRKGKVVYQNSQPVSTPAFRHIFELDNVDFWWPRGYGEAALYDASVQLID
SDGKELDTNNCKIGIRTVKLDMDDINLPGKPGQFRFIVNNEPIFIHGTNWVPMDALHSRD
KSHLNTMIDMAVDINCNMIRCWGGNVYEDTAFFNLCDENGILVWQDFGMGCTFYPQRDDF
AKMIEQEVTSVVLKFRNHASLILWSGNNENDLAMRWTLQPLNINPNKDVITRKVIARVLY
EFDPTRPYLPSSPYYSEAVWEHGGGDELLPENHLWGPRGYYKEPYYTKANCRFVSEIGYH
GCPNVESLNKMMTKDAVYPWTKDKEWNDEWVTKSTRRFPSQGKTFDRNNLMLNQVNLIFG
EVPAKLEDFAFASQAVQAEAMKFFVELWRGQKFSPKTGIIWWNLRDGWPIISDAIVDYYN
SKKMAYYFIKNAQTDLCVLINDPVDNAYPLIVTNDTRNAQKGQVVVIDVASNKEVYKGDF
EVSANSMNKIASLPQQKGQGILLIKYKVGQKEFSNHYLYGEAPFNLQEYKKLLKKTGLYP
SIK

Enzyme Prediction     

No EC number prediction in MGYG000001376_02521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	9	726	9.5e-91	0.6835106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.49e-64	11	716	13	673	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	1.58e-21	5	487	47	484	beta-galactosidase.
PRK10150	PRK10150	1.50e-16	13	451	15	419	beta-D-glucuronidase; Provisional
PRK10340	ebgA	5.47e-16	12	451	43	451	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	9.89e-09	13	147	4	133	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR15691.1	0.0	2	779	18	797
QRM99259.1	0.0	2	779	18	797
ANU59404.1	0.0	2	779	18	797
QNL40264.1	0.0	2	779	18	797
QUT78882.1	0.0	2	779	18	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	4.33e-108	2	722	18	717	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.66e-87	45	726	28	709	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.76e-87	45	726	30	711	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.81e-87	45	726	30	711	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.23e-87	45	726	28	709	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	2.82e-80	48	678	32	662	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
A2QYN2	2.18e-78	47	678	32	658	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q5B7W2	1.48e-77	46	678	31	658	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	1.53e-77	47	678	32	658	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B8NW36	7.56e-77	47	678	32	658	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_02521.