CAZyme Information: MGYG000001376_02505

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02505
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000001376_6|CGC6	73867.77	5.3364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 209677; End: 211614 Strand: +

Full Sequence      

MNRSKIFMLLAVVTGMLLCSCKAGDKAELQKEDLTLNFPNLLNVVHTPQGKVRQGQGYFT
DQGSWMGFSIPDKEAGSSGFCGPVDLDHRKWISNSICEVSVLDEKSTSIALRQDTAIYYP
GKLTLNLSGDKQSIRQELVFITANHALLRCKSDNEVYFVTEGYLNDSLIWNKESHGITAS
LKNGEIIMISFPEDILLELSAGRYIATSKDMGKQFDIVISYFNTKEDFLKKNGEIVDILA
NSDTRAEERNICWNHYIGQNLREDMPDKNNRIMVKSIMTLMSNWRSPKGALLHAGIVPSH
AMNYFVGFWAWDSWKHAVALSYLDPALAKDQIRAMFDYQDDAGMIADCIYTDPAENNYRD
TKPPLAAWAVNAIFQADKDTSFVAEMYPKLLRYHQWWYKFRDHDRNGICEYGATDGTLEA
AKWESGMDNAIRFDDAKMVKNGEKAWSMDQESIDLNAYLQYEYSLLKEFAAILNIPFNEP
DSKSLIQDYFFDKETGYFFDKKLNKPFIKVFGPEGWTPLWTGLATKEQADEAIKIMFDAK
KFSTYIPFPTAAADNPEFAPRGYWRGPIWIDQVYFAISGIRKYGYAKEADMYTQQVFDRL
QGLEDDAPIHENYDVYTGERLKASHFSWSAAHLFLLYKEYKKGYK

Enzyme Prediction     

No EC number prediction in MGYG000001376_02505.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	213	640	3.7e-105	0.5350877192982456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	6.83e-138	5	642	3	785	alpha-glucosidase; Provisional
COG3408	GDB1	6.43e-17	309	637	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	3.22e-08	361	615	178	475	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	3.39e-05	453	618	354	522	Neutral trehalase [Carbohydrate transport and metabolism].
PLN02567	PLN02567	7.12e-05	363	629	205	533	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIH36159.1	2.47e-235	37	641	13	612
QQY39153.1	3.01e-225	4	642	6	644
ABR39053.1	3.01e-225	4	642	6	644
ALK84236.1	8.56e-225	4	642	6	644
QEW38502.1	8.56e-225	4	642	6	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.96e-88	37	640	4	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.04e-87	37	640	4	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.45e-87	37	640	4	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	5.84e-85	37	640	5	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	6.02e-42	420	640	42	305	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.72e-87	37	640	27	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.82e-18	309	631	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	5.72e-18	309	631	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	1.38e-08	295	631	26	439	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000162	0.186987	0.812572	0.000098	0.000098	0.000079

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_02505.