CAZyme Information: MGYG000001376_01687

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_01687
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000001376_3|CGC10	44380.57	6.2691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 421619; End: 422782 Strand: -

Full Sequence      

MKRNIYYCLISLLLLPIFACNAKNNGEVKNEPSLKEALHGKFYIGTALNLDQIQGKDTAA
INIVKTEFDAIVAENCMKSMYLQPKEGEFYFEDADKFVEFGKQNNLFITGHCLIWHSQAP
AWFFTDDKGKDVSAEVLKQRMKNHITTVVSRYKGQIKGWDVVNEAIMEDGSYRESKFYKI
LGEEFIPLVFQYAHDADPDAELYYNDYNEWYEGKREAIARLVRSFKEKGIRIDAIGMQGH
ISMDGPSLEEYQAAIDAYTSAGVKVMVTELDLSSLPSPRRNTGANISEIEAYNKEMNPYT
TNLPDSVVVAWTERMGNFFKLFLDNKEKVSRVTLWGVTDKDSWKNNFPMRGRTDYPLLFD
RQYKAKPIVQEIIKMAGLSDNKAQNKK

Enzyme Prediction     

EC	3.2.1.8	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	33	374	1.2e-107	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	3.52e-122	34	367	1	303	Glycosyl hydrolase family 10.
smart00633	Glyco_10	6.20e-111	77	367	1	258	Glycosyl hydrolase family 10.
COG3693	XynA	1.32e-86	64	373	54	338	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACW01932.1	3.55e-180	1	373	1	376
ACP87304.1	3.55e-180	1	373	1	376
CCO21106.1	4.36e-180	1	375	1	373
CCO21151.1	4.36e-180	1	375	1	373
CCO21269.1	4.36e-180	1	375	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PMU_A	2.30e-99	33	373	2	350	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_C Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_D Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_E Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_F Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306]
4PMV_A	2.37e-99	33	373	3	351	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306],4PMV_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306]
6FHE_A	5.04e-94	27	373	5	339	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]
2Q8X_A	2.51e-92	32	367	6	323	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	3.55e-92	32	367	6	323	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49942	3.81e-158	10	376	6	372	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
P48789	1.13e-128	1	375	1	367	Endo-1,4-beta-xylanase A OS=Prevotella ruminicola OX=839 GN=xynA PE=3 SV=1
P45703	2.23e-84	32	373	6	328	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
O69231	3.41e-78	32	373	6	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P07528	1.91e-72	17	373	38	395	Endo-1,4-beta-xylanase A OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000019	0.010141	0.989868	0.000004	0.000006	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_01687.