CAZyme Information: MGYG000001374_00985

Basic Information

• Species: Mediterraneibacter torques
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter torques
• CAZyme ID: MGYG000001374_00985
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000001374_2|CGC1	28294.34	7.2166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001374	3092406	Isolate	not provided	not provided

• Gene Location: Start: 100687; End: 101397 Strand: -

Full Sequence      

MSKIIHYCWFGGSEKPPIVKKCIDSWKEYFPDFEIMEWNEQNFDIHNNRYVEEAYQSKKY
AFVSDVARFYALEKFGGLYFDTDVEVIKDFAPLLDQEAFAGFETDEYINPGLVLWVKEKN
NRLMKEMLNYYEGLSFIREDGSFNTTTICIYFTEILKQYGLIGNGKMQRCGNITIYPKEY
FCPFNDQTGVLNKTENTYAIHWYSKTWMEPKQKIRNKITRVLHRFFGTECFRRFRK

Enzyme Prediction     

No EC number prediction in MGYG000001374_00985.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	96	3.6e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	2.17e-16	16	100	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	8.01e-15	3	207	84	279	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	3.28e-13	3	132	48	193	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	2.87e-06	31	127	146	230	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam04572	Gb3_synth	0.005	152	205	28	95	Alpha 1,4-glycosyltransferase conserved region. The glycosphingolipids (GSL) form part of eukaryotic cell membranes. They consist of a hydrophilic carbohydrate moiety linked to a hydrophobic ceramide tail embedded within the lipid bilayer of the membrane. Lactosylceramide, Gal1,4Glc1Cer (LacCer), is the common synthetic precursor to the majority of GSL found in vertebrates. Alpha 1.4-glycosyltransferases utilize UDP donors and transfer the sugar to a beta-linked acceptor. This region appears to be confined to higher eukaryotes. No function has been yet assigned to this region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY96958.1	6.71e-151	1	235	2	236
QUF83025.1	2.89e-76	1	222	2	222
AJF34051.1	1.34e-74	1	222	2	222
ACD53458.1	1.34e-74	1	222	2	222
AJF30989.1	1.34e-74	1	222	2	222

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001374_00985.