CAZyme Information: MGYG000001373_00500

Basic Information

• Species: Faecalimonas sp000209385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp000209385
• CAZyme ID: MGYG000001373_00500
• CAZy Family: GH110
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1894	MGYG000001373_1|CGC6	207528.77	4.644

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001373	2218229	Isolate	not provided	not provided

• Gene Location: Start: 525261; End: 530945 Strand: +

Full Sequence      

MRMKKRLLAGVVTVCLLVAGFPVGFFSTGKPVLAKEKTGTVIDVTDFGADPGGKTDSTKA
VQKALEKAKETKGKVTLNFPKGEYHFWKDYATKRNYHTSNTSSLSYPEKSIAILLEGVDN
LTLEGNGSSLIMHGDMMAIAAVDSHNIKLHDFVLDYKDPDTVDLSVVGNGVDESGKQYAD
FYVPANYNYEINADKTGITWQGEMSPVTKRPYWEKSNADFCAYLVIYKGYDQTVARASNK
AASNPFANVASIEKAGENVLRFTYNGERPKDQEVGNIFLLSDSATRKTTGAFFWESEDVL
VENIDVHYLSGFGWLTQMCKNVEFKGVDFLPRYATGKYTTSNADQLHVAGCGGYFKVTDC
NFSMSHDDPINVHGSYMRVEEIIDNRTLKLKYIHSQQGGFRQFHKGDEVLFYSRTYLELP
DGSTEENPYIVESSVAPGEEYNGEKLDMRTEVVTFKEAFSEETLNDLKIKVRRNNSEEEE
GLYVAENVSYTAAVTISGNHMKSIPTRGILCTTRKPVVIEDNIFDNMTMANIYLSNDANY
WYESGPIRNMKIRNNKFYIRPTGQAEWGDVSGIFVDPVVLTSVQDAPASKGNIPVHRNIS
VEGNEFHMANDNVVTAEGVDGMTIKNNKIIRDNPGIEITLNDMEGLGIGETQDIKKEVKE
KTLPKDIFKFTNCKNVEISGNTYDDGLNLNVTTSGDKMTEDDVEIKDDVLTLNKEGNNLI
TSESKVHYITSDPTVAYVNEQGQLVGVADGTVTLTAYVEWNGTMIKSNSVEIPVGEGKGT
TVSIEADKTEITEEGGTAHLTITDGAEIEVLDPLTGKASNAATVKGNVYTALKEGAVLLK
ADKNGKSASVLMINRFPKSYGDVSKLNSSEVSVDNMHEKMLSGAKNEITIEAESNPKSDL
YGANTYVTNLVKLPILEEYKNDLRIQVDVDGLVVNGDGYNNAGIVLYKDGDNYYSVGKKG
HMSGVTAVYEEKASPSERGGDSADNKLTSTTFEIEIQNDTVTVRFKDASGKWKTANTQNA
ISKITDGKLYLAFTAWENGGKDFSSTFSNVKIAKASETTTENMNTVVPKQIFSAVSNERP
TVSSVDLKADKVNTEAKVTAKVSDSDGTVEKIIYEWTLENESGVKDVTYTSEGKYIPKEA
GKLSVRILAIDNLGKPSAVAKSEEVSVTVDKSDAETLRNLYINGNAVADFDKKDAKFVLP
DGASSKIRVSYDPENAGVKTVIKDKDGKVTLATLTDECAAVVDMQDGLTIERGSKVYKVA
LHTQKEGNVNIQKLSVDGKDVNLSEDEIKSGTNSYFINTDKDDVSIRMETEDKGTAFSVK
RSFFNIPVENASKDKGVFEADVDLTAGINAFYLTVKGADGITERTVRLYLFRDGFNNSAL
KDLKVNGKSLPDFAPDKTEYTMYVDNPQSVKVEAVQGAQEQQTNITKNSVRTDGVSASYK
LEDGLNQIVVANTSENMWTTTYYTVNVVVRSGSNADLLSLKTDETLLPGFDPLKPDVTEY
AVTMNNDSIHIEAQALMDNAKIRVFSDTEEKSGAGSIVTDMNIYEGKNVIGIEVTSPDGK
VKRVYTLDIDAEGFDYASDRMDISTKDEVGYGELGLDISSSGGAIALADEKGQRVEFKKG
LGAHASSEVAYNIEGQGYTAFESYIGIDYYQVSQGNVPSSVTFRVLVDGEEKYNSGEMTV
KDPMKKIKIDLTGASTIQLFADMGENNYNDHADWADAKFVKSLPEKPEKPKVNKITSVDK
VKDVEVAYGTKLKDIPLPKEVKVELDNGTTVELPVEWSCEKYNAEVAGKYVFTGTLTVPE
GIENPDGLMAETEVTVKEKPNDTTNPDNSGNNGSHSNNNSNSNSNGSSADKGENHQGAVE
TGDSFGMMMWISLLAILTSAGVIVVYFLRRKNRR

Enzyme Prediction     

No EC number prediction in MGYG000001373_00500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	41	634	7.9e-141	0.9543795620437956
CBM51	1585	1719	2.4e-34	0.9328358208955224

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08305	NPCBM	9.61e-37	1576	1719	4	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	1.59e-25	1588	1719	16	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
PLN02218	PLN02218	1.32e-09	32	131	58	168	polygalacturonase ADPG
pfam12733	Cadherin-like	3.20e-06	1485	1569	5	86	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
pfam12733	Cadherin-like	2.05e-05	1380	1467	1	86	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35188.1	8.52e-261	34	1400	37	1393
QAS60591.1	3.28e-260	34	1400	37	1393
ATD55583.1	1.45e-172	42	712	3	616
ATD56740.1	1.45e-172	42	712	3	616
QBJ75880.1	1.55e-172	42	712	5	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	1.04e-46	24	652	13	607	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	4.52e-46	24	652	13	607	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]
7JS4_A	2.15e-20	1555	1827	579	840	ChainA, F5/8 type C domain protein [Clostridium perfringens ATCC 13124]
2VMH_A	2.20e-18	1590	1704	22	134	Thestructure of CBM51 from Clostridium perfringens GH95 [Clostridium perfringens]
2VMG_A	2.59e-18	1590	1704	28	140	Thestructure of CBM51 from Clostridium perfringens GH95 in complex with methyl-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1V8K7	3.31e-116	36	774	28	723	Alpha-1,3-galactosidase A OS=Streptacidiphilus griseoplanus OX=66896 GN=glaA PE=1 SV=1
Q826C5	1.79e-97	27	693	26	624	Alpha-1,3-galactosidase A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=glaA PE=3 SV=1
Q89ZX0	1.08e-62	41	632	27	556	Alpha-1,3-galactosidase B OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaB PE=3 SV=1
Q8A2Z5	5.91e-62	64	629	34	532	Alpha-1,3-galactosidase A OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaA PE=3 SV=1
Q64MU6	1.07e-60	44	631	28	552	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000723	0.998118	0.000492	0.000274	0.000186	0.000158

TMHMM  Annotations     

start	end
7	29
1866	1888