CAZyme Information: MGYG000001371_03725

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_03725
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000001371_109|CGC1	43270.77	6.237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 7823; End: 8953 Strand: -

Full Sequence      

MKQESRWSVLTADTILSQADSEGLHSEIARRWAYVPGMMLMAIARTGDCYSKDAYIDFMK
RHMDLFVQADGDIRGYRIEEYNLDQINQGKNLFALSARFHDSRYEKASHTLAAQLIGQPR
TTDGGFWHKKVYPFQMWLDGLYMSSPFLAQYAITYNRPEWFDEVAHQLLLVERRTRDRKT
GLLYHGWDEAKEQVWADPESGRSPHYWSRALGWYAMALVDSLEYFPVNHPKRGTIMGIFE
RLSRALGRYQEKESGLWFQVLDQGFREGNYLETSGSSMFIYALAKGVRLQYLEQPSRSIA
ERAYEGLVQRFVEVNDTGVHLHSICHGAGLSDDRNGSYEYYISEKVVSDAQIGVAPFILA
SLEMERLEDSRVGGSL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	366	8.2e-114	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.88e-103	13	368	14	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.06e-94	7	367	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX65097.1	1.76e-280	1	376	1	376
QOT12516.1	1.69e-278	1	376	1	376
ANY75749.1	7.90e-246	7	370	6	369
QYR23596.1	2.35e-195	7	373	13	379
QZN76921.1	4.25e-190	7	367	9	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.35e-112	6	367	3	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.17e-89	1	367	10	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.89e-89	12	367	11	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	2.14e-17	101	366	117	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.42e-89	1	367	10	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.87e-39	143	363	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.87e-39	143	363	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_03725.