CAZyme Information: MGYG000001370_01662

Basic Information

• Species: Bacteroides fluxus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fluxus
• CAZyme ID: MGYG000001370_01662
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	MGYG000001370_29|CGC2	83291.37	6.8895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001370	4330086	Isolate	not provided	not provided

• Gene Location: Start: 57925; End: 60105 Strand: -

Full Sequence      

MKRLHLFCLLLCIALTAGASPVKGLIERVAPGSSGKFIIEQKPSSGIDFFELDQKGEKIV
IRGNNPVSIAAGLNWYLKYYAGIHLSWNKMTAELPGVLPPVTRKERHETASVYRYDLNYC
TFSYTMAFWDWARWEQELDWMALHGINLSLALVGTDAVWRNMLSKLGYSKEEVNEFVAGP
AFQAWWLMNNLEGWGGPNTDSWYEDRIALQKRILKRMREYGIHPVLPGYSGMLPHNAKEK
LGVNVSDPGTWCGYNRPAFLQPTDTRFGEIAALYYEEMNRLYGKADFYSMDPFHEGGKVA
GVNLDAAGQAIWQAMKKNSRNSVWVVQAWGANPRAQMIKNVPRGDMLVLDLYSESRPQWG
EPESSWYRENGFDGHQWLYCMLLNYGGNVGLHGKMQHVIDAYYKASRSSFGNTLKGVGMT
MEGSENNPVMYELLCELPWRPSTFSKDEWLEGYIAARYGKCTPRLREAWVLLGNSIYNCP
PRSTQQGTHESIFCARPSLKAYQASSWSEMSDYYRPQDVIRAAGLFLEEAGQFKGNDNFE
YDLVDITRQAVAEKGRLIYKVIQASYEAGDKPLLRQASDRFLELLLLQDRLLATRPEFKV
GRWIEQARNLGHTPAEKDWLEWNARVQITTWGNRTASDRGGLRDYAHKEWNGLLKDFYYL
RWKTWLDRLNDLPDRDPASSIDYYSLEEPWTLRHDTYSSTKEGDCVETAKAVQRQLFSPE
ETTHIN

Enzyme Prediction     

No EC number prediction in MGYG000001370_01662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	56	713	1.6e-251	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	114	441	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.61e-97	449	710	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	5.65e-32	20	99	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50280.1	0.0	1	717	1	716
QRO24616.1	0.0	1	719	1	718
QRP91352.1	0.0	2	716	3	717
QCQ40346.1	0.0	2	716	3	717
CUA17253.1	0.0	2	716	3	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	5.78e-158	22	690	174	846	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	7.19e-158	22	690	182	854	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	8.38e-157	22	690	197	869	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.71e-135	19	712	6	707	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	1.78e-134	19	712	29	730	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	6.16e-127	20	718	47	802	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005546	0.988884	0.004772	0.000291	0.000255	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001370_01662.