CAZyme Information: MGYG000001370_01474

Basic Information

• Species: Bacteroides fluxus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fluxus
• CAZyme ID: MGYG000001370_01474
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
941	MGYG000001370_24|CGC1	104084.88	5.5562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001370	4330086	Isolate	not provided	not provided

• Gene Location: Start: 66838; End: 69663 Strand: +

Full Sequence      

MRKLIAAVLLLSNSALLTAQKTMKVPATYKPTKSEMYHKGWIDFNKNGVMDVYEDPAATV
DARVEDLLKQMTLDEKTCQMVTLYGYKRVLKDALPTPEWKQMLWKDGIGAIDEHLNGFQQ
WGLPPSDNENVWPASRHAWALNEVQRFFVEETRLGIPVDFTNEGIRGVESYKATNFPTQL
GLGHTWNRALIHKVGLITGREARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAEL
GIEMVRGLQQHVAATGKHFAAYSNNKGAREGMARVDPQTSPHEVENIHIYPFRRVIKEAG
LLGVMSSYNDYDGIPIQGSYYWLTTRLRDEMGFRGYVVSDSDAVEYLYTKHGTAKDMKEA
VRQSVEAGLNVRCTFRSPDSFVLPLRELVKEGGLDEETVNDRVRDILRVKFLIGLFDAPY
QTDLAGADKEVEKEENEAVALQASRESVVLLKNENSTLPLNINTVKKIAVCGPNADEDGY
ALTHYGPLAVEVTTVLKGIQDKVNGKAEVLYTKGCDLVDANWPESEIIDYPLTPDEQAEI
NKAVENARRADVAVVVLGGGQRTCGENKSRSSLDLPGRQLQLLQAVQATGKPVVLILING
RPLSVNWADKYVPAILEAWYPGSKGGVALADILFGDYNPGGKLTVTFPKTVGQIPFNFPC
KPASQIDGGKNAGPDGNMSRINGALYPFGYGLSYTTFEYSNLEITPKVITPNEKATVRLK
VTNTGKYAGDEVVQLYTRDVLSSVTTYEKNLAGFERIHLEPGETKEVTFILDRKHLELLD
ADMKRVVEPGDFAIMAGASSEDIRLNGLLTVEDYQTRTQAIESRKSASRVSASTNPESTG
NVLDGKINTAWQGNKGDYITFALKNGSKTDKVSIAFTRDNNLPAHFEIQLSGGGGQFLTV
YSGTVSEYGKLVSYSFKGTTASDLRIVLNDDRVGVAEVKLE

Enzyme Prediction     

No EC number prediction in MGYG000001370_01474.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	150	373	1.2e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.35e-177	61	804	35	758	beta-glucosidase BglX.
PLN03080	PLN03080	1.36e-99	108	797	66	769	Probable beta-xylosidase; Provisional
COG1472	BglX	7.33e-73	137	504	41	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.62e-68	448	694	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.42e-63	72	409	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT34231.1	0.0	1	939	1	941
ADV43554.1	0.0	1	940	1	942
QUT62569.1	0.0	1	939	1	941
QQA31118.1	0.0	1	939	1	941
QUU00111.1	0.0	1	939	1	941

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	8.17e-129	141	804	69	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.41e-128	141	804	69	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	5.96e-122	47	804	30	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	3.78e-120	141	808	68	748	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5YOT_A	3.90e-120	53	812	7	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.56e-141	153	801	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	6.37e-130	61	804	35	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	6.37e-130	61	804	35	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	3.99e-122	53	804	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.23e-96	55	803	32	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000704	0.997224	0.001530	0.000210	0.000175	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001370_01474.