CAZyme Information: MGYG000001368_02415

Basic Information

• Species: Muricomes fissicatena_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes fissicatena_A
• CAZyme ID: MGYG000001368_02415
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1229	MGYG000001368_5|CGC2	134483.8	4.381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001368	5374587	Isolate	not provided	not provided

• Gene Location: Start: 39561; End: 43250 Strand: +

Full Sequence      

MRVKRFICKLMTCCIAAIVFSVSVPYASVSMADTNEEKEIGSEGKEDEAMTEDMDQADVV
DNNTDITAQANRSGDEKIPLPKISFEQGETYTNYSNGNDQANPVKIEVIENEGITDGNRA
MKVTYGASLWPGFHLYAEEGKVWDFGTDSCLSFDVTNTMQNAVELCVKFDCSVANDVGQD
AVFKVTIPAEKTIKVNTAASATGAELGMLANPPSNAGVSAAYGWGTGVVDYSAIKHITFW
LNGCAKETTLIFDNISVISDPNQDLQSSYSNLVDTYGQYNGIDHSNKIRSDEDFQTSKNT
EEILLAEQLEQTKAREISAYYGMKNEAYRQEATGHFYTKKLEGKWMLIDPQGYPYVSTGL
DIIRLADAQTWVSGREFMFEGLPAQDGELGEHYADVANCLRPPFGQNAGKAFNFYTANLE
RKYGDTWEEAWKENAVRRFKAWGFSSMGCWADPDMFYGKGAEYEFPYVAHAWVNQNHAKL
SSGGSWGDISDPFDPAFAAEAMGQMQALADKGVNSDPYCMGIYVDNEIAWGNSGVPAQRF
SVIKEAFKRDANQADIYAKKEFIAALKDKYADIGELNTAWGTQLASWESVESSYDGAIAE
EDASMCLSLLADKYYRVISAAVKEKLPDILYLGSRLAQWGCGSEVIQACAKYADVVSFNC
YKTDAEQEFMQLGTYDKPVIIGEFHFNACDRSHFAPGLVQVGTQEARANAYTNYMTGVFQ
NEYLVGAHWFQYYDQPVLGRAWDGENSNCGFVDMTDQPYAELVAAAKAVNESAYDIRLTY
TAAASISISQSEASLTPAERDLRLSAEVLPETASNREVLWSSSNERVAAVSQDGLVTAHK
NGTAVITVTSKDNRQLAASCAVTVSGFQESERKKFPNVSFEEGEEDVFTITAGRPMHIAR
VTGEGVTEGKQALRVTVNELVKDPNAWNFSLLQANNAEGWDFDDGMPLALNVTNINPFDI
QIRVNVTDNGGSIRTFYFVIPSKNTRTLKIAEFGKSEDVWGAEEGYFGANAGLNAEKITN
ISIYMWENSDLLGEDIVSASYVIDDVNAGKTKVTVSEIILSANRLVLTKESPTGRLTAQV
KPEAVSDSGVVWSSTDEKVAVVGQDGTVTARGDGKAFITAQSLINPDVAERCEVVVTGFA
AEGDGEDKPKEPNGEDPKEPNGEKPKEPNGEKLKEPNGEKPVGLPKTGDKTALPVAGLAV
TLAALSVLGAVFLRQYKRKENRTTQKPAQ

Enzyme Prediction     

No EC number prediction in MGYG000001368_02415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	141	774	2.5e-163	0.9770290964777948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02368	Big_2	3.07e-15	784	862	1	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
COG5492	YjdB	2.94e-10	771	864	169	261	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
pfam02368	Big_2	8.52e-09	1058	1120	3	64	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
smart00635	BID_2	2.38e-07	785	853	4	74	Bacterial Ig-like domain 2.
pfam17992	Agarase_CBM	2.08e-06	116	264	24	174	Agarase CBM like domain. This is the N-terminal CBM-like domain in exo-beta-agarase proteins (EC:3.2.1.81) found in the marine microbe Saccharophagus degradans. This enzyme catalyzes a critical step in the metabolism of agarose by S. degradans through cleaving agarose oligomers into neoagarobiose products that can be further processed into monomers. The CBM-like domain is structurally very similar to some CBM families. A loop in the CBM-like domain is involved in forming the roof of the active site channel. The contribution of the CBM-like domain to formation of the active site of the enzyme supports a role in substrate recognition explaining the exo-mode of beta-agarase action.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI25447.1	6.17e-222	78	777	36	735
QTH40851.1	1.73e-206	80	1046	188	1058
QGG56465.1	9.51e-206	80	1046	188	1058
QUI22698.1	2.07e-183	79	777	193	888
QUI25446.1	6.64e-181	80	1050	292	1198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	1.50e-114	130	778	51	747	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	4.01e-114	130	778	51	747	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	5.41e-109	224	777	175	762	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	3.23e-103	218	777	169	762	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.57e-122	48	777	199	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	6.00e-88	112	774	233	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1
P33747	3.19e-08	783	865	37	118	Uncharacterized protein CA_P0160 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_P0160 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001626	0.997245	0.000515	0.000221	0.000198	0.000178

TMHMM  Annotations     

start	end
7	29
1191	1213