CAZyme Information: MGYG000001368_00612

Basic Information

• Species: Muricomes fissicatena_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes fissicatena_A
• CAZyme ID: MGYG000001368_00612
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802	MGYG000001368_1|CGC7	94384.11	5.5311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001368	5374587	Isolate	not provided	not provided

• Gene Location: Start: 707149; End: 709557 Strand: +

Full Sequence      

MADNRRREKIRVLVHNSAKEAEHFHQDIELLYIMEGSLDVKVGEQMTHMFPEDILVINAN
KMHTLKGSEDILYAQLLIEYNMVSDLFDSMNIIFWCNSTKDESERYDKLRAAIKELLNHH
LSTRGNSASFAHISLCYRVLDLLSGYFLVQTADKELMDDGDKFDERIDQINNYIRANYSQ
PISLKELADKLYLSNGYLSRFFKKNYGMNFAEYLTNIRLFHAVDELMYTNTPITMIAYDN
GFASVAVFNKAFKKAYGETPSALRKRLKEQKEEPKQQTEDTVIEERLEQYLITSQTEKKE
VNQVEQQENSHSVKNTEQMKNWGRTLNVGMASDLLKSEIQEHVMLLKESLDFEYARFCNP
FTREMLLDPEKSEGHYNFSRIDTILDFLIRFGIKPHIEMGPKPRMITYNVQKVEVEGTRN
VEFANVKEWEELLEALFRHLTQRYGRSALDFWRIELWFNENKWDDPESMVVYFDLFRTLK
STVKKYNSKIEVGGCGIRLDNSEQSRIVFYQNWMKQASKPDFISMIIFPYDRGVDGQDHY
AKRCTDNECLKHRVESERELLRITGFENTTLYVTEWNMTISARNFINDSCFKGAYIIKNL
LDVYGIADDLAYWLGSDRNSEYYDSNELVNGGTGLMTKDGILKPAGFAFEFMKRLYSNCA
GKGENYLISTDGADSYGIVCHNQRTLGYNYYFTKEDELEKEHLWKYYEDRDELDLKLELR
DVADGRYKIKMYRINEQNGSVLNIWQELDFEPELSRNDIKYFRRMCEPRLIIQKTEAKDH
TLKLNILMQANEIVFVRVRRLP

Enzyme Prediction     

No EC number prediction in MGYG000001368_00612.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	318	748	3.6e-60	0.9721577726218097

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2207	AraC	2.87e-30	164	269	19	124	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
COG3664	XynB	8.83e-30	334	802	1	428	Beta-xylosidase [Carbohydrate transport and metabolism].
pfam01229	Glyco_hydro_39	4.05e-28	322	655	18	350	Glycosyl hydrolases family 39.
smart00342	HTH_ARAC	1.10e-26	181	264	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	4.94e-23	187	266	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB55960.1	1.71e-235	5	799	2	798
QMW76172.1	1.71e-235	5	799	2	798
AGF58080.1	1.54e-206	19	798	20	798
AQR96769.1	4.90e-205	19	798	20	798
BBG22497.1	2.20e-195	9	801	9	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BS9_A	4.93e-39	320	800	16	482	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	1.64e-38	320	800	16	482	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
1W91_A	2.22e-38	320	800	16	482	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
4M29_A	9.51e-38	324	801	24	499	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.73e-37	324	801	24	499	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q936F1	2.89e-33	32	802	27	743	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2
Q9ZFM2	3.12e-33	320	800	16	483	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
Q7A882	1.59e-32	32	802	27	743	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1
Q99XB1	1.59e-32	32	802	27	743	Uncharacterized HTH-type transcriptional regulator SAV0101 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0101 PE=4 SV=1
Q6GKK1	2.11e-32	32	802	27	743	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001368_00612.