CAZyme Information: MGYG000001367_01462

Basic Information

• Species: Clostridium_Q symbiosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_Q; Clostridium_Q symbiosum
• CAZyme ID: MGYG000001367_01462
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
937	MGYG000001367_2|CGC1	104728.28	4.561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001367	4857868	Isolate	not provided	not provided

• Gene Location: Start: 677893; End: 680706 Strand: -

Full Sequence      

MEGRQEGILDDTQELTTENMPENQPGDQPEAELMGQPEKTPEKTASNEPEQESEVSADGR
DETPAENHEASSLVSHTGTNMQNEPEDVRDQEADEQLHQRKPRSRKSQKQEKKQQRKVKK
AEKQKKPDNSKGLWKYIKIIFRSMFKVLKVTFMTLFIICVIALVAVLGIGAYKVYPMYLE
YKTQVEGIVEASTPDTFRLQEASFIYDANGEVLAKLTGDEDSSYLTYDEIPEYAVNAFIA
IEDRTFWDNSGIDIKGIFRVAINYFKTEGEEKHGASTITQQLARNRFLTREVSIERKAKE
MLIAMDLTKKYTKKQIMEFYINDISFANTYYGLQAAARGYFGVDANDLSLSQIAYLCAIP
NSPSYYNPYKHPENAIKRRDKILGDMKDMGFITEKEYSQALEETINVQRMKTPMRNYETT
YAIDCAIRYLMRMDGFDFKYGFQDKSEYLEYKDRYEEVYNQERDNLYTGGYTIYTSLEPD
KQRILQESVDSVLTFDEAVAENGIFALQGAATVIDNSTNRVVAIVGGRSQDTDTYTLNRA
FQSFRQPGSTIKPLIVYAPALENGYKSTTMVKNIKVQDAKQKDAVVKDLPGDMMTLRTAV
EKSRNGVAWYVYDDITPELGMSYLTQMRFDNIVPDDYYPASALGGFTYGATTEEMAGAYS
ALADSGRYKEPTCIVKMLDNEGNNVFEEYPVIQVYQENTANVMTDILKGVISRGTAASMG
WRSSIEAAGKTGTTNSSKDGWFCGMTPYYTISVWVGYDQPKMLSNLYGATYPASIWKKTM
EQLVEGLEPASFTEPGPETGIGDGSQYLPGRDDDELLSDGYTVGDFRKDHALADAAQELI
DQMRKSGSGAKKQFKAEAQALINQITGDTLRNRMTGILNSSGSNGTGAQAPPPVLPPAEL
PSQEEAPPETVPSGPGSDTGSPGKQNVPQGPAAEIIE

Enzyme Prediction     

No EC number prediction in MGYG000001367_01462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	210	387	1.5e-63	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	4.08e-167	224	786	4	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.73e-163	144	798	7	611	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	7.08e-139	153	795	6	730	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.02e-76	209	387	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	5.12e-76	182	799	111	694	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK80882.1	4.04e-233	173	875	88	801
BAK46854.1	4.22e-233	179	792	96	715
BCK01696.1	1.16e-199	172	792	86	703
BCN28959.1	1.69e-195	179	792	56	666
CBK77227.1	4.99e-189	170	590	153	573

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.50e-70	188	795	7	772	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	6.29e-68	198	795	16	734	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.28e-58	205	800	10	604	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3UDF_A	3.61e-56	205	790	23	722	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
2OLU_A	2.29e-55	205	761	19	570	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	6.20e-92	199	781	52	621	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
P38050	5.81e-80	199	795	45	607	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	1.67e-76	188	798	35	681	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q97GR5	2.31e-73	199	819	70	701	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1
Q891X1	8.16e-73	201	799	59	674	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
150	172