CAZyme Information: MGYG000001365_00845

Basic Information

• Species: Phascolarctobacterium_A succinatutens
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A succinatutens
• CAZyme ID: MGYG000001365_00845
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		35971.15	4.502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001365	2121560	Isolate	not provided	not provided

• Gene Location: Start: 63060; End: 64058 Strand: +

Full Sequence      

MRCLPTAFCHASTVLALPDGSLLCCWFGGTHEGESDVGIYISRRTDAGWSEPKLLVNGAA
ANWNPVLFAGADGRLLLFYKQGQQIADWQTWLLQSTDNGETWSGPQELVPGDVSGGRGPV
RNKPLRLASGRILAGASTEHGIWKAFADISDDDGASWHKSSAVQIEGLQYQTGEKTADSN
IAVSQQSFYGRGVIQPSLWQSADGSVHMLLRSSEGFVYRSDSADDGETWCSAYALSLPNN
NSGLDLVRTAGGVLYLVCNPVAANWGQRSPLSLFKSTDEGASWQKLFDLETEPAEFSYPA
IIADGEDLMLTYTYKRCNIACVRLSADELVTL

Enzyme Prediction     

No EC number prediction in MGYG000001365_00845.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	9	310	9.7e-29	0.8830409356725146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	2.71e-87	20	306	1	275	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	7.35e-59	9	324	33	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	5.34e-49	5	316	10	326	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
smart00602	VPS10	9.03e-05	208	327	3	107	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77693.1	3.46e-248	1	332	7	338
ALS21221.1	9.75e-120	5	327	16	338
AUS95056.1	3.44e-119	9	327	20	334
AZS14954.1	2.40e-105	7	320	18	330
QYR20881.1	9.74e-104	5	325	17	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YA4_A	5.02e-06	91	229	238	382	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]
5KKY_A	5.03e-06	91	229	241	385	Structureof Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae],5KKY_B Structure of Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae]
6QZH_A	5.95e-06	91	229	426	570	Structureof the human CC Chemokine Receptor 7 in complex with the intracellular allosteric antagonist Cmp2105 and the insertion protein Sialidase NanA [Homo sapiens]
2W20_A	6.51e-06	91	229	217	361	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
3H72_A	6.55e-06	91	229	221	365	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.924379	0.075165	0.000242	0.000093	0.000051	0.000101

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001365_00845.