CAZyme Information: MGYG000001364_01245

Basic Information

• Species: Phocaeicola plebeius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius
• CAZyme ID: MGYG000001364_01245
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000001364_4|CGC2	63570.78	6.8662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001364	4421324	Isolate	not provided	Asia

• Gene Location: Start: 107345; End: 109054 Strand: -

Full Sequence      

MKHFGKMIVGACTVLTLTCTPAQLLAQSLSPSTQWEWNKGTIVIKSPERPTGQESVIGLT
VPKMNVVRVGFVGLGMRGPGAVERFTHIAGTKIVALCDYEKERAERCQKYLQKACLPEAA
VYSGAEGYKALCEREDIDLVYIAADWDHHFPIAKYAMEHGKNVAIEVPSAMNLEQCWELI
NLSETTRKHCMILENCCYDWFEMNTLNMAQQGVFGEVLRAQGAYIHNLDDFWPYYWKNGK
EDKLGWRLRYNKENRGDVYATHGLGPVAQALNIHRGDRMTTLVAMDTKSVHGKALVEKAT
GEPCDEFRNGDHTTTLIRTENGKVIEIQHNVMNPQPYNRLYQLTGTKGFANKYPVEGYAV
DAAQMKASGVQPKVDNLSSHSFLPEKEMEALVNKYQHPILKKYGEMAKEVGGHGGMDFIM
DSRMVYCLQNGLPLDMDVYDLAEWCALAELGAISMDNGCAAVAFPDFTRGHWNDVKGFHH
AFATPEDEAAAELAAETATLSLKAQGMKEWLAKSKKAEVSKEEAEARVKQLSTQLEKTQK
KANGAESKELKDAVKQAEKMLKQAQKMLK

Enzyme Prediction     

No EC number prediction in MGYG000001364_01245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	473	4.8e-158	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.87e-24	64	361	1	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.04e-13	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	8.29e-09	67	217	5	145	putative oxidoreductase; Provisional
PRK10206	PRK10206	7.81e-04	136	185	64	113	putative oxidoreductase; Provisional
cd06503	ATP-synt_Fo_b	0.002	515	566	40	102	F-type ATP synthase, membrane subunit b. Membrane subunit b is a component of the Fo complex of FoF1-ATP synthase. The F-type ATP synthases (FoF1-ATPase) consist of two structural domains: the F1 (assembly factor one) complex containing the soluble catalytic core, and the Fo (oligomycin sensitive factor) complex containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. F1 is composed of alpha (or A), beta (B), gamma (C), delta (D) and epsilon (E) subunits with a stoichiometry of 3:3:1:1:1, while Fo consists of the three subunits a, b, and c (1:2:10-14). An oligomeric ring of 10-14 c subunits (c-ring) make up the Fo rotor. The flux of protons through the ATPase channel (Fo) drives the rotation of the c-ring, which in turn is coupled to the rotation of the F1 complex gamma subunit rotor due to the permanent binding between the gamma and epsilon subunits of F1 and the c-ring of Fo. The F-ATP synthases are primarily found in the inner membranes of eukaryotic mitochondria, in the thylakoid membranes of chloroplasts or in the plasma membranes of bacteria. The F-ATP synthases are the primary producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). Alternatively, under conditions of low driving force, ATP synthases function as ATPases, thus generating a transmembrane proton or Na(+) gradient at the expense of energy derived from ATP hydrolysis. This group also includes F-ATP synthase that has also been found in the archaea Candidatus Methanoperedens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24012.1	0.0	1	512	1	513
QCQ31109.1	0.0	5	510	6	511
QEW37947.1	7.44e-308	1	516	1	517
QJR75586.1	1.10e-307	1	516	1	517
AND19749.1	1.10e-307	1	516	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.62e-84	49	472	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	3.06e-66	67	487	21	443	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	8.33e-08	66	224	12	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3E9M_A	9.38e-07	103	236	39	167	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3EVN_A	3.87e-06	64	229	3	161	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	4.26e-308	1	516	1	517	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	2.12e-300	1	516	1	516	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	2.01e-242	24	503	19	498	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	5.83e-213	1	483	2	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
P0C863	3.01e-211	2	483	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000393	0.590558	0.408401	0.000230	0.000209	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001364_01245.