CAZyme Information: MGYG000001363_01324

Basic Information

• Species: Streptococcus equinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus equinus
• CAZyme ID: MGYG000001363_01324
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	MGYG000001363_1|CGC16	20544.49	3.9961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001363	1718648	Isolate	not provided	not provided

• Gene Location: Start: 1342355; End: 1342948 Strand: -

Full Sequence      

MQTNIFKTNSNSIKLGLAGVAAAVALIAPTVANADSYTVQSGDTLSKIAVTYNTTVEKLA
SVNQIADVDVITVGQILELDPEATVASVETSAEAAAPAANSAETVAAAPAETTTTSSYAS
NLGTSDAQAKEIIAQRESSGSYTAQNGQYYGRYQLTMSYLNGDLSAENQERVADSYVAGR
YGSWSAALAFWNANGWY

Enzyme Prediction     

No EC number prediction in MGYG000001363_01324.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00257	LysM	2.28e-12	37	77	2	42	Lysin motif.
cd00118	LysM	3.87e-12	36	79	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	2.36e-11	37	77	1	40	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1388	LysM	6.55e-05	28	79	60	110	LysM repeat [Cell wall/membrane/envelope biogenesis].
PRK10783	mltD	1.19e-04	28	79	337	387	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE23841.1	1.31e-115	1	197	1	197
QGX44358.1	2.54e-113	1	197	1	197
QMS96339.1	2.54e-113	1	197	1	197
QGX46117.1	2.54e-113	1	197	1	197
VTS91603.1	4.20e-112	1	197	1	197

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000268	0.999087	0.000162	0.000178	0.000162	0.000136

TMHMM  Annotations     

start	end
13	32