CAZyme Information: MGYG000001360_02039

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_02039
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000001360_1|CGC31	86475	7.6419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 2436849; End: 2439221 Strand: -

Full Sequence      

MKIARCNVTVLLLMACGLCLNLKAKGHFPYQNEKLPTAQRVTDLLRRMTLDEKIGQLRCM
LAWDYYIRNRQQIELSDTFKKDIAEGKIGMLWATFRADPWTKKSLENGLTPYLAAQTANK
LQQYAIQNTRLGIPLFLAEEAPHGHMAIGTTVFPTGLGLAATWNNTLAEAIGQCIARQIR
QQGAHISFGPVLDLTRDPRWSRVEECMGEDPVLTAVIGASMVKGLGGGKHSQPHATIPTL
KHFVGYGTTEGGQNGCQTVGGLRDVCQNFLLPFEKAIQAGATSVMTSYNSLDGVPSTGNR
WLYDDVLRKRWNFSGFVLSDLYSIDGLWHTHHVTHTLAEAGGMALKAGVDIDLGGRAYAL
LPEALEKGWITEHDIDSACARVLRMKFEMGLFEHPYVNAAEAKTIDNEADKALALKAAQQ
LITLLKNSNQCLPLQRKAKIALVGPNANNVYNMLGDYTAPQQEGHVKTVLMGLQTKIPAA
QLRYVKGCAIRDTANSNIDEAVAAAKWADVVVAVVGGSSARDFKTDYQATGAAMVNASTV
SDMESGEGYDRASLTLTGRQEELLKAVKKTGKPLVVVYIEGRPLQKNWAATHADALLTAY
YPGQEGGQAIADVLFGDINPAGRLPISVPVSVGQLPCYYNKRMPSPHDYVEMSAAPLYPF
GYGLSYTTFSYDKMRTEKTGRNAYRISFEITNTGDTDGEEVAQLYTHDQVASVVQPLLQL
KHFKRIFIPKGQTKCVTFDLEPKDFSLINAEMQSVVEARSIDIGIGGASNKLPLHAVIQT
EAETLSPPYK

Enzyme Prediction     

No EC number prediction in MGYG000001360_02039.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	127	353	2e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	11	766	6	751	beta-glucosidase BglX.
COG1472	BglX	5.84e-84	48	477	1	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.39e-75	49	385	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	6.05e-71	5	756	6	759	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.32e-58	422	666	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14396.1	0.0	10	781	13	784
QVJ80985.1	0.0	14	776	9	777
ADE83756.1	0.0	14	776	9	777
ALO48411.1	0.0	24	774	29	780
QYR10513.1	0.0	16	774	11	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	3.15e-130	30	772	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	1.01e-129	30	783	7	759	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
6R5I_A	3.27e-129	41	766	7	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
7EAP_A	7.76e-129	30	783	7	759	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5O_A	1.79e-128	41	766	7	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.04e-133	41	766	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.50e-126	41	772	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	7.33e-119	120	780	52	721	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.78e-112	30	769	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	7.40e-89	17	766	15	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000550	0.997146	0.001729	0.000192	0.000174	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_02039.