CAZyme Information: MGYG000001360_01451

Basic Information

• Species: Prevotella salivae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella salivae
• CAZyme ID: MGYG000001360_01451
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000001360_1|CGC19	54173.88	9.0278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001360	3139873	Isolate	not provided	not provided

• Gene Location: Start: 1693232; End: 1694653 Strand: -

Full Sequence      

MKYNLLLLIALILVVLPAKGHVIDGEGAPSSSTNQRLSANHSLRAPLYWSVYEHCWLKEK
AGEQHIDITQAQWDSIINWVATNLKPYGYEMICTDGFIPMLAENGAPYMTRYGSITLKEL
IKKCKAKGLKVGVYDNPLWIHGDDSVHVRGTKDVTIGDLRYRSSDKVLHKDTTDRWFSWV
VATRPGAKAYIDGFFKHYHDLGVDFIRMDFLSWYEDGFDRNMGRVGRGYGRDSYQLALQY
ICEAARKYGVFTSLVMPHLYEKAMLEARYGNMIRVVADTGDGGWKHFSAAHRGQFFPTWP
NYDNMFDGFIYWSSLSGRDKIILDGDFTRLNTFANANEMESVISLQLLAGGPIAVADRPS
SIGNRVSFYQNKELLRLNKERFVGKPLSVDHHDVRSQIWAGKLTDGSWIIGFFNREDTPQ
VRQIDFRQLGLKGKWHIRDMWKHTDERPDEAYQVTLAPHACKVIHLTKAMKSR

Enzyme Prediction     

No EC number prediction in MGYG000001360_01451.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	187	445	3e-27	0.9344978165938864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	3.63e-14	397	466	5	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
PLN02229	PLN02229	6.36e-05	371	473	316	424	alpha-galactosidase
PLN02808	PLN02808	1.16e-04	338	467	252	384	alpha-galactosidase
cd14791	GH36	2.22e-04	117	301	67	242	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	5.69e-04	80	378	28	269	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14482.1	0.0	1	473	1	473
QUU07210.1	1.36e-188	24	468	37	492
QUT44530.1	1.93e-188	24	468	37	492
QUT79686.1	1.93e-188	24	468	37	492
QRM98947.1	1.93e-188	24	468	37	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	1.42e-95	36	467	23	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]
4NX0_A	1.70e-06	68	470	39	444	Crystalstructure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_B Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_C Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_D Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_E Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_F Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_G Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_H Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	7.86e-96	36	467	49	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1
Q9FXT4	2.85e-06	185	467	161	415	Alpha-galactosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os10g0493600 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.999224	0.000147	0.000149	0.000135	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001360_01451.