CAZyme Information: MGYG000001352_04394

Basic Information

• Species: Clostridium_AQ sp000165065
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp000165065
• CAZyme ID: MGYG000001352_04394
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000001352_25|CGC1	36525.19	7.1423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001352	4458401	Isolate	not provided	not provided

• Gene Location: Start: 27634; End: 28641 Strand: -

Full Sequence      

MKLKHIALIGSLFPILFSLVLFFGVLISADSDDENSNFSSGITGMNLSAEVLKHQPMVEK
YAREYGISEYVNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLDTESSIKQGCKYFASLL
SSCKNQGIDDLNVAIQSYNYGGGYVGYVAGKGKKHTFNLAESFAREKSGGKKVTYTNPIA
VAKNGGWRYGYGNMFYVELVNQYLTVPQVSGELAQKVMNEALKYQGWKYVYGGSNPNTSF
DCSGLVQWCYGKAGISLPRTAQAQYDATQHLPLSQAKAGDLVFFHSTYNAGSYVTHVGIY
VGNNQMYHAGDPIGYADLSSSYWQQHLIGAGRVKQ

Enzyme Prediction     

No EC number prediction in MGYG000001352_04394.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	7.20e-62	48	204	1	165	Lysozyme-like.
cd16891	CwlT-like	1.29e-54	54	204	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	9.64e-39	226	332	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	3.16e-34	214	333	366	481	invasion associated endopeptidase.
COG0791	Spr	1.03e-28	214	330	75	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU68201.1	2.64e-243	1	335	1	335
AYD09683.1	2.64e-243	1	335	1	335
AYD07873.1	2.64e-243	1	335	1	335
QOQ51898.1	2.64e-243	1	335	1	335
QUP83050.1	2.64e-243	1	335	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	6.77e-218	29	335	2	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	7.40e-142	30	333	5	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	1.36e-17	214	333	14	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
2K1G_A	4.19e-15	212	333	4	123	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
6BIQ_A	8.39e-15	210	320	154	264	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	5.21e-77	14	334	15	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	1.24e-25	217	333	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	7.46e-25	220	333	415	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01836	2.47e-24	220	333	358	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
Q01838	2.17e-23	217	333	411	523	Probable endopeptidase p60 OS=Listeria seeligeri OX=1640 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.200384	0.794905	0.003698	0.000330	0.000286	0.000369

TMHMM  Annotations     

start	end
7	29