CAZyme Information: MGYG000001350_01226

Basic Information

• Species: Fusobacterium periodonticum_B
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium periodonticum_B
• CAZyme ID: MGYG000001350_01226
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	MGYG000001350_24|CGC1	59123.05	7.3335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001350	2454675	Isolate	not provided	not provided

• Gene Location: Start: 97223; End: 98719 Strand: +

Full Sequence      

MKRECGVLLAISSLPSAYGIGDFGKEAYRFVDFLEASGQSLWQILPLCPVEYGNSPYQSP
STFAGNFLYLDLEDLVDNEYLTQGDIDVLKSEVSSVDYEYIKSQKESLLKKASQAFFYKN
TEESEFKKFQSENQFWLEDYALFLSLNKKFKGKMWNTWDKGYKFRERKSIEEAKKEFEEE
YKYESFIQYYFYKQWKKLKDYANSKGIKIIGDLPIYVASNSADTWQHPKLFCFDKHLKIK
AMAGCPPDYFSKKGQLWGNVLYDWEAMKKDNYSWWEQRIKHSFLLYDILRLDHFRGFASY
WAIRYGEKTAINGRWEIGPRIQFFRDLERKVKNIDIIAEDLGTLTADVFKLLRQTNYPNM
KVLQFGLTEWDNMYNPKNYTENSVAYTGTHDNMSMVEWYSTLNKNEKFICDENLKNFLNN
YNTNIWEPIQWRAIEALYASKSNRVIVPLQDILGLGADSRMNTPSTVGDNWVWRVYWEYR
HGDLENKLYNLAKRYQRI

Enzyme Prediction     

No EC number prediction in MGYG000001350_01226.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	9	490	7.7e-160	0.9838056680161943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	498	3	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	9	475	1	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	6.46e-180	1	498	12	515	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PLN02635	PLN02635	1.05e-153	1	498	26	526	disproportionating enzyme
TIGR00217	malQ	6.51e-126	2	474	13	490	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV58680.1	0.0	1	498	1	498
ATV71875.1	0.0	1	498	1	498
ATV57919.1	0.0	1	498	1	498
ATV66045.1	0.0	1	498	1	498
ATV67457.1	0.0	1	498	1	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	3.27e-122	3	479	22	487	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	2.22e-117	2	475	4	474	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
2X1I_A	2.53e-114	1	475	1	477	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1X1N_A	2.92e-113	2	475	25	498	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
2OWC_A	8.50e-113	1	475	6	479	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	2.92e-143	11	497	3	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q1	4.66e-133	2	498	3	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	4.66e-133	2	498	3	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
O66937	6.79e-122	3	479	2	467	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P72785	1.28e-118	2	476	4	478	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.458823	0.539869	0.000397	0.000369	0.000249	0.000281

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001350_01226.