CAZyme Information: MGYG000001346_03439

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_03439
• CAZy Family: CBM62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000001346_15|CGC16	75683.77	6.0936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 1096316; End: 1098274 Strand: -

Full Sequence      

MKHWCVWVWFTAGLFMACSSENQWLDTALNLAGDNRAELQKVLDRYKEEDGDKYRAACFL
IENMPFHGAYEGKALENYRKYFSEYVSFPYSRHVQELIDSLKRADGEFSINQLTYKRDIM
TVDSAFLVNHIEWAFKVWREQPWGKHVDFDTFCEYILPYRIGDEPLSLWRKEIYECYSPI
LDEFRKTDEADNPKVAAQLLMDTLRKANYRNTALFPVGPHLGPDVLKWHTGSCREFTDAM
IYVLRALGIPCGVDRVMVLGDNNASHFWNFVLDKEGKTYIANLPYEEVWSKAEEYSISRG
KMYRATYSIDKEAVRKLGKYSDVYPAFRRPFFRDVTALYTGSRNWTVALPDSLLSGQFRE
GDMVYLCLANRLQWQPIGYTFFKKREARFEDVGGGAVFTLAAWNGKEYAAVSSPFLLERE
TGKIRFIVPEAEKQELVLYRKCHLTLSVLFNDRMIGGVVEGSDRADFGWKDTLLLIKEAP
YRLYTVARLKSDKPYRYMRYKGADGCFCNISELAFYENTEDTIPLYGEIIGTPGSFEDNT
HEYLNAFDGNPDTSFDYIHPDGGWTGMDFGSPHRVEKVVYTPRNEVNFIYKGNLYELFYW
GGGKWNSVGRQMAVSDSIVYSGFQGALFYLKNHTAGKDERIFEYKDGKQIFW

Enzyme Prediction     

No EC number prediction in MGYG000001346_03439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM62	450	517	6e-18	0.5114503816793893
CBM62	525	585	6.4e-16	0.46564885496183206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01841	Transglut_core	7.00e-05	185	277	6	102	Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.
smart00460	TGc	7.63e-04	225	276	1	60	Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
pfam00754	F5_F8_type_C	0.002	535	608	6	80	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT66433.1	0.0	1	652	1	652
QQA29412.1	0.0	1	652	1	652
QUT60882.1	0.0	1	652	1	652
QUT35039.1	0.0	1	652	1	652
QUT97869.1	0.0	1	652	1	652

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000474	0.303159	0.696023	0.000114	0.000112	0.000108

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_03439.