CAZyme Information: MGYG000001346_01822

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_01822
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000001346_14|CGC8	79640.75	6.1737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 472945; End: 475011 Strand: -

Full Sequence      

MKIKIFAVVCLLAANLFTISAQKWFTPEAEKQVDALLSQVVEGNYKNNRYPLLRKPLMEL
PLGSIKPKGWLHEMLVRQKNGASGQMDVLYPSVMGKRNGWLGGDGDQWERGPYWIDGLLP
LAYILDDDVLKAKVQPWIEWALQSQREDGFFGPEKDYPGEPGLQRDNSQDWWPRMVVLKI
LQQYYSATNDKRVVAFMTKYFRYQLNTLPQKPLGHWSSWAEFRACDNLQAVYWLYNLTGE
DFLLELGHLLHRQSFSFIDMVDRGDLRRPCTIHCVNLAQGIKEPIIYYLQDTDRKYIDAV
KEGFRDIRRFHGQPQGMYGGDEALHGNNPTQGSELCSAVELMYSLEKMVEITGDIDFADH
LERIAFNALPAQISDDFMTKQYFQQPNQVMVTRHRRNFDQDHEGTDLAFGTLTGYPCCFS
NMHQGWPKFTQHLWYATPDNGIAAIVYSPSEVTANVGDNVPVVISEDTYYPMDHQITFTI
KEVRNKVKQVKFPFHLRVPKWCKQAEIRVNGKMEQTVKGGKIAIVDRIWKRNDKIELYLP
MEVFTSTWYENAVSIERGPLVYALKMEENWEKKEFKDSWYGSYYYQVTSSDPWNYGLVDF
DRNRMNEVAQVSINSQKQQLDFPWNQENAPVEIKMKARLIPTWTVYNEMAGPQPFSFCGS
AEGGEQEITLIPYGCTTLRISEFPVVGK

Enzyme Prediction     

No EC number prediction in MGYG000001346_01822.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	332	563	1e-33	0.42748091603053434

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.06e-57	113	563	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.36e-28	328	564	286	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	1.45e-165	45	687	28	652
ALL07583.1	1.74e-163	43	687	26	652
AMP98056.1	4.87e-163	42	687	25	652
ARS39276.1	1.91e-161	48	688	29	650
QNK64903.1	2.24e-160	45	687	22	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	1.09e-16	328	565	375	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.75e-16	114	569	82	566	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.53e-14	328	569	327	566	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	3.71e-06	328	599	332	583	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	3.74e-06	328	599	332	583	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000204	0.999209	0.000161	0.000154	0.000141	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_01822.