CAZyme Information: MGYG000001346_00170

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_00170
• CAZy Family: CBM50
• CAZyme Description: Integration host factor subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000001346_12|CGC4	43591.24	4.2263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 182005; End: 183186 Strand: +

Full Sequence      

MNEKLNIQDLIDTLAERHGMSKKNADSFVKEFFQLIEESLEKDKYVKIRGLGTFKLIDVG
SRESVNVNTGERFEIQGHTKVSFTPEPALKDIINRPFSHFETVVLNDATVLEDTLQENDS
EDDEDTEIKTPEQEVEEKVALVEEATIEEPLVETVVEEPLVEPEPEVEEEKPEKTEPEAM
PENIVAVEPEPSEPVIKDTADSSTMKYFIGIVVFVVLLCGGAVAFMYYPDLLDKLTAKPL
VEEVADSDVKESVTEKVDVPAGQDNIALTDSIVSKDVVVPARTDTVAETVATTTPALTTT
PKENVQVQSPAPKKEQKKTVAPFEPDSVGYTIVGTETTYTIKEGETLTRVALRFYGTKAL
WPYIVKHNPGVIKNPDNVPYGTTIKIPKLAKKQ

Enzyme Prediction     

No EC number prediction in MGYG000001346_00170.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00216	Bac_DNA_binding	1.32e-21	6	93	1	88	Bacterial DNA-binding protein.
COG0776	HimA	8.87e-18	4	96	1	93	Bacterial nucleoid DNA-binding protein [Replication, recombination and repair].
cd13835	IHF_A	2.70e-17	8	93	3	88	Alpha subunit of integration host factor (IHFA). This subfamily consists of the alpha subunit of integration host factor (IHF) and IHF-like domains. IHF is a nucleoid-associated protein (NAP) that binds and sharply bends many DNA targets in a sequence specific manner. It is a heterodimeric protein composed of two highly homologous subunits IHFA (IHF-alpha) and IHFB (IHF-beta). It is known to act as a transcription factor at many gene regulatory regions in E. coli. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). IHF is also involved in formation as well as maintenance of bacterial biofilms since it is found in complex with extracellular DNA (eDNA) within the extracellular polymeric substances (EPS) matrix of many biofilms.
cd00591	HU_IHF	9.75e-17	8	91	2	85	DNA sequence specific (IHF) and non-specific (HU) domains. This family includes integration host factor (IHF) and HU, also called type II DNA-binding proteins (DNABII), which are small dimeric proteins that specifically bind the DNA minor groove, inducing large bends in the DNA and serving as architectural factors in a variety of cellular processes such as recombination, initiation of replication/transcription and gene regulation. IHF binds DNA in a sequence specific manner while HU displays little or no sequence preference. IHF homologs are usually heterodimers, while HU homologs are typically homodimers (except HU heterodimers from E. coli and other enterobacteria). HU is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). Bacillus phage SPO1-encoded transcription factor 1 (TF1) is another related type II DNA-binding protein. Like IHF, TF1 binds DNA specifically and bends DNA sharply.
cd13832	IHF	1.04e-16	9	91	3	85	Integration host factor (IHF) and similar proteins. This subfamily includes integration host factor (IHF) and IHF-like domains. IHF is a nucleoid-associated protein (NAP) that binds and sharply bends many DNA targets in a sequence specific manner. It is a heterodimeric protein composed of two highly homologous subunits IHFA (IHF-alpha) and IHFB (IHF-beta). It is known to act as a transcription factor at many gene regulatory regions in E. coli. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). IHF is also involved in formation as well as maintenance of bacterial biofilms since it is found in complex with extracellular DNA (eDNA) within the extracellular polymeric substances (EPS) matrix of many biofilms. This subfamily also includes the protein Hbb from tick-borne spirochete Borrelia burgdorferi, responsible for causing Lyme disease in humans. Hbb, a homodimer, shows DNA sequence preferences that are related, yet distinct from those of IHF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA31617.1	4.90e-250	1	393	1	393
BBK88465.1	4.90e-250	1	393	1	393
QUT63421.1	4.90e-250	1	393	1	393
QUT99387.1	4.90e-250	1	393	1	393
QUT36753.1	4.90e-250	1	393	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HUE_A	4.61e-11	5	93	1	89	ChainA, HU PROTEIN [Geobacillus stearothermophilus],1HUE_B Chain B, HU PROTEIN [Geobacillus stearothermophilus],1HUU_A Dna-Binding Protein Hu From Bacillus Stearothermophilus [Geobacillus stearothermophilus],1HUU_B Dna-Binding Protein Hu From Bacillus Stearothermophilus [Geobacillus stearothermophilus],1HUU_C Dna-Binding Protein Hu From Bacillus Stearothermophilus [Geobacillus stearothermophilus]
5LVT_A	5.77e-10	6	93	3	90	Structureof HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403],5LVT_B Structure of HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403],5LVT_C Structure of HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403],5LVT_D Structure of HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403]
4QJN_A	3.27e-09	5	93	1	89	ChainA, DNA-binding protein HU [Staphylococcus aureus subsp. aureus Mu50],4QJN_B Chain B, DNA-binding protein HU [Staphylococcus aureus subsp. aureus Mu50],4QJN_C Chain C, DNA-binding protein HU [Staphylococcus aureus subsp. aureus Mu50],4QJN_D Chain D, DNA-binding protein HU [Staphylococcus aureus subsp. aureus Mu50],4QJU_A Chain A, DNA-binding protein HU [Staphylococcus aureus subsp. aureus Mu50],4QJU_B Chain B, DNA-binding protein HU [Staphylococcus aureus subsp. aureus Mu50]
5J0N_I	7.96e-09	9	90	6	87	ChainI, Integration host factor subunit alpha [Escherichia coli],5J0N_K Chain K, Integration host factor subunit alpha [Escherichia coli]
1IHF_A	8.56e-09	9	90	7	88	INTEGRATIONHOST FACTOR/DNA COMPLEX [Escherichia coli],1OUZ_A Chain A, Integration Host Factor Alpha-subunit [Escherichia coli],1OWF_A Chain A, Integration Host Factor Alpha-subunit [Escherichia coli],1OWG_A Crystal structure of WT IHF complexed with an altered H' site (T44A) [Escherichia coli],2HT0_A IHF bound to doubly nicked DNA [Escherichia coli],5WFE_K Cas1-Cas2-IHF-DNA holo-complex [Escherichia coli S88]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8J836	1.44e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=ihfA PE=3 SV=1
B4UAP1	1.44e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=ihfA PE=3 SV=1
Q2IJA7	1.44e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=ihfA PE=3 SV=1
A7HBJ3	3.55e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=ihfA PE=3 SV=1
Q65TL4	8.84e-11	9	90	7	88	Integration host factor subunit alpha OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=ihfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
207	229