CAZyme Information: MGYG000001345_04276

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_04276
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	MGYG000001345_36|CGC20	68283.38	7.4785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 996459; End: 998273 Strand: -

Full Sequence      

MKKILLLLLIFVSGYTGVVAQQFDYGKIAPHPRLLLPAGGEEAIRKAIAEYPPLATVHQR
IMELCDRTLTEQPVERIKEGKRLLAISRIALKRIYYLSYAYRMTGDKKYAHRAEQEMLAV
SRFTDWNPTHFLDVGEMVMALAIGYDWLYDSLQPDTRRVVREAIIAKGFDAAKNTRHAWF
YTAKNNWNSVCNSGLAYGALALFEEIPEVSKGIIEKCMETNPKAMVGYGPDGGYPEGFGY
WGYGTSFQVMLIAALESAFGTDNGLSQAPGFMESARFMQYMTAPGGDCFCFSDSPVEAEC
NMMMFWFAGKAKDLSLLWIERQYLDRPDMQFAEDRLLPSLLVFCSQLDLKHIGKPKRNFW
FSRGDTPVFIYRGGWDSKEDTYLGVKGGSPSTSHAHMDAGSFIFERDGVRWAMDLGMQSY
ITLESKGVDLWNMSQNGQRWEVFRLSNIAHNTLTINGERHLVKSNAPITRTFESKKQKGA
EVDLSSVFANSVKKVVRTVILDQKDHLEVTDRLETGDKEAAVSWIMVTPAEAKITGKNRM
ELTKDGQRMLLTVDADTEVEMKTWSNVPPHEYDFRNPGTIRVGFETVIPANRASQLKVRL
IPLK

Enzyme Prediction     

No EC number prediction in MGYG000001345_04276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	379	556	4e-66	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	9.56e-16	377	591	18	224	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16332	DUF4962	1.58e-08	29	249	135	365	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT31751.1	0.0	1	604	1	604
CBK67360.1	0.0	1	604	1	604
QUT26392.1	0.0	1	604	1	604
QRQ54739.1	0.0	1	604	1	604
ALJ47853.1	0.0	1	604	1	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	7.09e-11	31	285	139	408	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	7.09e-11	31	285	139	408	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000251	0.999141	0.000158	0.000154	0.000145	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_04276.