CAZyme Information: MGYG000001345_00625

Basic Information

• Species: Bacteroides xylanisolvens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides xylanisolvens
• CAZyme ID: MGYG000001345_00625
• CAZy Family: GH20
• CAZyme Description: Chitobiase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	MGYG000001345_30|CGC5	95898.17	4.8771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001345	5913018	Isolate	not provided	not provided

• Gene Location: Start: 164785; End: 167310 Strand: +

Full Sequence      

MITMRNIWIMMLGICLFGCGAGKQPPSSQLSLTWKLEKDSVEARYFKNTFCLTNNGNKSL
TNNWVIYFNQTPIYYQQPINAPLEIECLGSTYYKMYPTEHYQALPPGETITFTILSEGNV
INVSSVPEGAYVITTDEKGKPLQPQNVPIEIELFKPDTQWVSSRDSFPYADGNYFYKQND
DFSKPVDCDMLSLFPAPKKVEKTGGVSSFSQKVCLKFDDAFKEEALLLKSQLTSLLRCSV
SDKDEETIIELKKMEVPITCQYPDEYYEIVIKNNRLTLKASDTHGIFNACQTLLALLDNM
ELTSSPLPNLHITDYPDMGHRGIMLDVARNFTKKADLLKLIDILSFYKMNVLHLHLSDDE
AWRVEIPGLEELTEIASRRGHTIDEQTCLYPAYAWGWNETDTTSLANGYYSRSDFMDILK
YAKERHIRVIPEIDIPGHSRAAIKAMNARYQKYIDTDQSKAEEYLLTDFADTSQYLSAQN
FTDNVINVAMPSTYHFLEKVIDEIVRMYQDAGVELTAFHVGGDEVPEGIWEGSSICRTFM
QENGLTKIRDLKDYFLEQILEMLDKRNIQAVGWQDIVMNPDNTVNEHFKNSKVLNYCWNT
IPEQGGDEVPYKLANAGYPIILCNVGNFYLDMAYCYHVEEPGLRWGGYVDEYVTFDMLPF
DIYKSLRRNLKGEPVDVKAASNGKQPLTKEGYQNIKGLSGQIWSETIRSFEQVEYYLFPK
VFGLAERAWNVQPSWALSPDGKVYMDAKRKYNAGIIDYELPRLAKRGINFRVSPPGIMTR
DGLLLANTAIPNAVIRYTTDGSEPTESSIEWQTPVVCNAPLIKAKAFYLGKESVTTVLFN
R

Enzyme Prediction     

No EC number prediction in MGYG000001345_00625.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	319	730	7.5e-99	0.9525222551928784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	0.0	314	740	1	426	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	4.63e-108	319	729	2	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
cd06563	GH20_chitobiase-like	2.58e-107	319	729	2	342	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
COG3525	Chb	7.01e-93	265	805	206	679	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd02742	GH20_hexosaminidase	1.99e-60	320	729	1	302	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT31033.1	0.0	1	841	1	841
QUT25549.1	0.0	1	841	1	841
QUR46113.1	0.0	1	841	1	841
QDH52947.1	0.0	1	841	1	841
QRN00147.1	0.0	1	841	1	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	2.41e-96	50	812	44	826	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	4.66e-96	50	812	44	826	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	2.41e-95	50	812	44	826	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	1.37e-68	193	771	142	638	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	1.67e-67	193	771	139	635	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54468	3.12e-95	50	812	71	853	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P13670	8.04e-95	47	801	66	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q04786	1.43e-90	52	801	47	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P49007	5.98e-86	161	753	182	750	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P96155	8.65e-63	187	725	135	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000173	0.999859	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001345_00625.