CAZyme Information: MGYG000001343_01798

Basic Information

• Species: Acinetobacter junii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter junii
• CAZyme ID: MGYG000001343_01798
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000001343_44|CGC2	26455.42	9.6481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001343	3338999	Isolate	not provided	not provided

• Gene Location: Start: 464604; End: 465278 Strand: +

Full Sequence      

MKAFLARAVMLIIGVILLIQLWIFASLVWWRTNPVETTMFMRLDYWSDMKPIQQDWRDYD
EISDNFKHAILAAEDAKFVHHHGFDWAGIQHALERNNEKGEVVAGGSTISQQLAKNLFLY
NQRSFIRKGQEAVATWMMERMWSKRRILEVYMNSVEFGENIYGVEAATQYYYGKSSKSLT
REQAAFLAALLPNPKYYQDHRNDRKLQYRKRVILRYMNGTQLPE

Enzyme Prediction     

No EC number prediction in MGYG000001343_01798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	53	217	3.5e-62	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02070	mono_pep_trsgly	2.97e-109	7	223	2	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK00056	mtgA	4.49e-106	1	218	1	224	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	1.71e-73	53	218	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.77e-72	2	217	14	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.49e-52	58	217	6	165	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXR09957.1	1.99e-162	1	224	1	224
QXR28667.1	1.99e-162	1	224	1	224
AWA47400.1	1.99e-162	1	224	1	224
QUY35805.1	1.99e-162	1	224	1	224
QQV66860.1	1.99e-162	1	224	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.26e-33	60	224	26	192	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	8.91e-33	60	224	26	192	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.07e-28	59	217	44	202	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	4.17e-25	58	214	43	199	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5U2G_A	4.32e-25	69	214	55	200	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0V9M4	1.01e-138	1	224	1	225	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain AYE) OX=509173 GN=mtgA PE=3 SV=1
B7GXW9	1.01e-138	1	224	1	225	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain AB307-0294) OX=557600 GN=mtgA PE=3 SV=1
B7I8R1	1.01e-138	1	224	1	225	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain AB0057) OX=480119 GN=mtgA PE=3 SV=1
B2HVP6	1.01e-138	1	224	1	225	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain ACICU) OX=405416 GN=mtgA PE=3 SV=1
B0VSQ2	1.44e-138	1	224	1	225	Biosynthetic peptidoglycan transglycosylase OS=Acinetobacter baumannii (strain SDF) OX=509170 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999655	0.000196	0.000045	0.000001	0.000001	0.000129

TMHMM  Annotations     

start	end
9	31