CAZyme Information: MGYG000001342_02054

Basic Information

• Species: Streptococcus gordonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
• CAZyme ID: MGYG000001342_02054
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000001342_5|CGC7	40838.74	3.9189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001342	2230611	Isolate	not provided	not provided

• Gene Location: Start: 496541; End: 497704 Strand: -

Full Sequence      

MNEERCTLHMKINKKMLFASTVALSVFPLITANAEEESQNWTARTVDQIKADITSSENQQ
TYTVQYGDTLGTIAEAFDLDVNVLAHINAIANIDLIYPNTVLNITTNDKNEITGVEITSP
QATRAVTGPVSEPAPATPVQPEAAPAETTAPSTEANAEVPAAPVTDAPVAPAPVEEQASS
DAPAVPAEAQSAPEAASSQVAAAAEVSEPQSAEPITEPAAPATPAQPEATQAEAVTQAAP
QLDQEQVNQDVTNIESPTYTAPAVATQTSNNAANEGLRPQTAALKEEIAAKYGITEFSLY
RPGDSGDHGKGLAADFIVGNNTELGNQVAADVTSNMTGRGISYVIWQQKFYAPFDSIYGP
ANTWNQMPDRGSVTENHYDHVHVSMNE

Enzyme Prediction     

No EC number prediction in MGYG000001342_02054.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	5.00e-10	60	104	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK10811	rne	7.56e-09	115	279	879	1041	ribonuclease E; Reviewed
smart00257	LysM	8.78e-09	61	104	1	44	Lysin motif.
PRK10811	rne	3.86e-08	112	266	847	999	ribonuclease E; Reviewed
pfam01476	LysM	6.13e-08	62	105	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC46502.1	9.97e-224	10	387	1	378
VTS76503.1	5.02e-210	10	387	1	378
VEE20221.1	5.02e-210	10	387	1	378
QGS44520.1	5.02e-210	10	387	1	378
ATF64398.1	4.78e-194	10	387	1	378

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000348	0.998836	0.000258	0.000191	0.000172	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001342_02054.