CAZyme Information: MGYG000001342_01279

Basic Information

• Species: Streptococcus gordonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
• CAZyme ID: MGYG000001342_01279
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697	MGYG000001342_4|CGC2	80803.81	5.2757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001342	2230611	Isolate	not provided	not provided

• Gene Location: Start: 208576; End: 210669 Strand: -

Full Sequence      

MKPMLETIDTRYGTDNSHSISRGNTLPYTGAPFGMNYFVPQSSHTDGSWFFNPDSPIFQG
IRLTHQPSPWIGDYSWLLITPVSEKILHSDIYHRQSSYRPDESIFQPHYLKINSNRYQIS
TELTPSRYGARFRLTNQREQPISLILHSEAKMVFQQVDAYTLLGSLKEETKPAKQPLVMH
VCLRFDQPIKKQSFLDQDLVLDFEQGQLQFSLATSFISEEQALINLPQSSFDELKEETKQ
DWEVFLHRFDIVDQGKIDRRMFDQALYRLFLFPQTFYELDAEGQEIHWDFTHQTVQPGKL
FTNIGFWDGFRTSFPLLALMAPDTYHDFLEGFLNFYKETGFLPKWLAPDERGMMPGTLID
GVIADAAAKNLIPDLEKDLFQAMLETAEKDDPSKRYGRQGASDYQTLGYLPFDYHESVSH
SLDYSYSDFCIASLANKLQQKSVAQRYSQQSLNYQHLFDPETGYMRAKDRKGQFRPDFSP
YTWGRDYAECSAIQNTLSIFHDIEGLKNLMGGQTAFTDYLTKLCQDQPFFDVTGYGYEIH
EMSEMATAHFGQLAISNQPSFHIPYLFRYSDKPEYTSLLIKSLREQGFRPGWQAFPGDED
NGSLSAWYIWSAIGLYPTCPGKPFYDLGIPLFNHLRLYLPQSQTWLDIYAHDNYPHFQFV
TKTELDGQALQHISHEELLVAKRLDFHLSWLPNSSKE

Enzyme Prediction     

EC	3.2.1.113

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	200	689	1e-136	0.9816700610997964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3537	COG3537	0.0	1	693	35	744	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
pfam07971	Glyco_hydro_92	5.94e-147	221	689	1	464	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
TIGR01180	aman2_put	1.14e-82	24	693	47	749	alpha-1,2-mannosidase, putative. The identification of members of this family as putative alpha-1,2-mannosidases is based on an unpublished characterization of the aman2 gene in Bacillus sp. M-90 by Maruyama,Y., Nakajima,M. and Nakajima,T. (Genbank accession BAA76709, pid g4587313). Most members of this family appear to have signal sequences. Members from the dental pathogen Porphyromonas gingivalis have been described as immunoreactive with periodontitis patient serum. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
NF035929	lectin_1	8.84e-37	208	661	254	654	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
pfam17678	Glyco_hydro_92N	4.92e-20	8	202	2	200	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQG04765.1	0.0	1	697	1	697
ATF64827.1	0.0	1	697	1	697
ARC46905.1	0.0	1	697	1	697
AOS72121.1	0.0	1	697	1	697
ALD71785.1	0.0	1	697	1	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5SWI_A	0.0	1	693	24	716	Crystalstructure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_B Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_C Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_D Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae]
6DWO_A	3.41e-217	5	693	3	698	Crystalstructure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_B Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_C Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_D Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
7FE1_A	3.41e-217	5	693	3	698	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
7FE2_A	9.68e-217	5	693	3	698	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
2WZS_A	3.39e-123	2	696	1	722	Structureof the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86365	1.29e-46	5	644	42	702	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999623	0.000391	0.000010	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001342_01279.