CAZyme Information: MGYG000001342_00554

Basic Information

• Species: Streptococcus gordonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
• CAZyme ID: MGYG000001342_00554
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		25689.35	4.317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001342	2230611	Isolate	not provided	not provided

• Gene Location: Start: 62676; End: 63365 Strand: +

Full Sequence      

MKKKMSALLAVMTVFMSAVMISALLANNTKSVDANEEQTVQYYNPTEVFISQIAESARQL
GQENDLYASVMIAQAILESNSGRSGLASAPHYNLFGVKGHYGGQSATMLTWEDDGQGNAY
NIDAEFRSYPSYYESLQDYVAILRQGYYANAWKSNTTSYQDATAALTGVYATDSSYNAKL
NYIIEKYNLTQYDTPSYQQAYSGDLVYNIYRQQYTSQEILDEDVAWANR

Enzyme Prediction     

No EC number prediction in MGYG000001342_00554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	54	189	9.5e-28	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	3.69e-63	30	195	304	474	amidase domain-containing protein.
PRK06347	PRK06347	5.19e-63	47	194	151	304	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	1.95e-62	1	194	5	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	7.59e-27	40	193	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.90e-25	49	193	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQG04144.1	8.03e-160	1	229	1	229
VTS80201.1	1.14e-159	1	229	1	229
ABV10136.1	1.14e-159	1	229	1	229
QGS43498.1	1.14e-159	1	229	1	229
ALD72406.1	1.14e-159	1	229	1	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.16e-45	47	193	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.89e-41	46	193	60	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	3.42e-14	49	186	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.63e-14	49	186	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	3.92e-46	38	196	169	336	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	8.54e-41	13	196	28	217	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	1.19e-40	13	196	28	217	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q2G222	6.03e-40	46	193	320	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P39046	1.60e-39	46	208	62	229	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003988	0.878147	0.116949	0.000362	0.000280	0.000243

TMHMM  Annotations     

start	end
7	26