CAZyme Information: MGYG000001340_01790

Basic Information

• Species: Weissella paramesenteroides
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella paramesenteroides
• CAZyme ID: MGYG000001340_01790
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1329	MGYG000001340_13|CGC9	152640.86	6.9659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001340	1962181	Isolate	not provided	not provided

• Gene Location: Start: 408923; End: 412912 Strand: -

Full Sequence      

MDLKKKVKRLAHISEVAMTYKYSALKKTREYYIRHYDQSTIDEQTILYEARDGQSMTDSP
LAIFRYLNNHERYQHLKHVWVVTDNSPENLARMVANIPSNMQDNIIWVKRNTIAYAKWLL
KAKFLITNSTFQSFWHKKPDQIYVNTWHGTPLKYMGYDIPGSKTSLKNVQRNLLMADYII
SPNAHTSYVFLDRYKLNGLYQGEVLESGYPRIDLTYGHDQAQTIAYLLQSGVRIDRDKPI
VMYTPTWKGTSITNPSGSINQIFEEIKCLKQLNPDKNILVKVHPYAYQLAKRHEKLHQYL
VPDEMDANLILGVTDILITDYSSIFFDYLVTDKPIIFYAWDHELYSSYRGMYFDDDELPG
PIIEDIMTVGRTLQVIDQVHTQYQQKYQQLKEKIVAYDDGQVTERIVQTIFDQQLVPGIK
HLKANDSAKTKLLIYPGGMGNNGITTSAINLSRNLDYDKYDVTYLLWDSDNEEIVHNVDQ
LDDRVRVIYRFGVTALTRPEHKQDRYISEHGIKSWSDTNIPKTGYQREADRLFNSVQFDD
LIDFSGYSFNGSKLFAVMPRKQLIVYQHNDLYADSQKIIKGKQVHAKKLGALFTLYQVFD
KIISVSETLKQINETKLAKYIRPEQMVAVPNSLTVPTGIDEELADSPVIEDYQAAASMRQ
QTVEMFMSLTDIVHGKAVTKEISANEHVRVLGRAQINHSTFYKLAVNDLPSSWVAAKSVE
VYEVNELLYQAPVHQIGWVYNNKRRLFQTPYLKGNDASDVIGQAKWLNHTFVKIVAQAET
GDGRYYQVKLPKSQQDAWIKASSILPMQVSPHFAMYQWLWNCLSNKVTEQAYHVGIKQLF
TITHEVVLTNQPLGLSKRGLKQRQLKTVNKLYIATAFAQTLTGNYFRIQIGQKQWWIDEH
DINKQIINVPLSDNYQINLSDYLEVPLNQSLIFNQHSEQLVRTQLGTLPDDLMIIAGYSN
ANFIDNQSVYQLYSAKFGESMMVSVNDVIVLDTSHFNEVYAISRETTITYQSMLLSQQSQ
QINIKDSLVELARVWNWQTQSFMIYGYFVNKFGWFDESVLTSDHVKQLVVQENILPDEHS
GVQLEADTLPVNDIQPVVKINQPWITRKVSVHEAGKHYTQLQRQNGQTTLLTNTGESTLA
SDVQQAASDTLLYRNGRQWATYDHFVFVAVGRLSPEKNQTMLLDAFAKVYVKHPEAELII
VGDGVSRDELENKAVALGIANVVLFTGQVDNPADYVALADVFVHPSLYEGQPMVLLEALM
QQRLIIATNIAANIGVLGNQEYGLVTKDVTSRAFERLMLFVMEKQTNLAKFNIETYQKHA
RRAFHAILK

Enzyme Prediction     

No EC number prediction in MGYG000001340_01790.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1164	1304	3.8e-30	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	3.46e-83	41	411	2	359	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	7.77e-70	24	414	7	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
cd03811	GT4_GT28_WabH-like	4.57e-39	1163	1324	187	348	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam00534	Glycos_transf_1	1.49e-29	1165	1303	3	143	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03808	GT4_CapM-like	3.99e-29	1163	1270	188	295	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF41405.1	0.0	1	1329	1	1329
QPI46515.1	0.0	1	1329	1	1329
APS41578.1	0.0	1	1329	1	1329
CCC56535.1	0.0	1	1329	5	1334
QDJ58642.1	0.0	1	1329	3	1328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.40e-41	8	406	321	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.04e-40	8	406	321	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.39e-40	8	406	321	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G1C1	9.28e-43	42	411	26	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	7.15e-41	8	406	321	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKI5	2.11e-36	42	380	30	358	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	7.46e-35	41	411	379	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C2	1.22e-18	138	411	241	511	Teichoic acid ribitol-phosphate polymerase TarK OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001340_01790.