CAZyme Information: MGYG000001337_01832

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_01832
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000001337_2|CGC40	88202.03	8.9864

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 1633432; End: 1635771 Strand: -

Full Sequence      

MNQILKPHNLPPSFQGRGWKISIKSWWKPALFLLLVLYIFCLPSQLFTSPYSTVVTDRNG
ELLGARIATDGQWRFPPRDNIPEKVATCLIEFEDRQFYHHWGVNPLAIGRAVVQNLKHKR
IVSGGSTLTMQTIRLARNKPRTFKEKLIEMVWATRLEFRKSKKEILSLYISHAPFGGNVV
GLDAAAWRYFGHSAEELSWAESAMLAVLPNSPAMIHLSKSRQALLDKRNRLLTHLHKKGI
LDTSTYELAISEPLPQEPLPLPHIAPHLTDYFYQTRNGKYSVSTIDRGIQTQIESLVERW
NSEFKRSDIRNLAILVIDIRTNQAIAYCGNVHFDKEQSGNQVDVIRSPRSTGSILKPFLY
YAMLQEGEILPNTLLPDIPVNINGFAPQNFNLQFEGAVPASEAIARSLNIPSVTMLQRYG
VPKFHSFLKQIGLTTLNRPSSHYGLSLILGGAEATLWDITSAYANMGRSLNRLPQFPCTL
LLSDSISVHRPSFQSGAVWQTFDAIKEVNRPEEIDWRTIPSMQTIAWKTGTSYGFRDAWA
VGVTPKYAVGVWVGNATGEGKPGLVGARTAGPVLFDVFNLLPSSPWFERPQGELVEAEIC
RQSGHLKGRFCEETDTLLILPAGLKTEACPYHHPVTLSANERFRIYENCANSEPVVRRNW
FTLPPVWEWYYKQHHPEYRPLPPFKSGCGEDRFQPMQFIYPPMGARIHLPKQMDGSKGQL
TVELVHSHPNTTIYWHLDETYLTQTQDFHKLSLRPSPGKHSLTAVDDEGNTISTTFFVE

Enzyme Prediction     

No EC number prediction in MGYG000001337_01832.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	76	234	2.1e-46	0.8983050847457628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	43	779	2	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	0.0	22	779	2	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	4.64e-120	26	779	9	772	penicillin-binding protein 1C; Provisional
TIGR02074	PBP_1a_fam	2.70e-95	74	573	2	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.94e-95	30	576	30	591	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKA51279.1	0.0	1	779	1	779
QRP90812.1	0.0	1	779	1	779
CBW21957.1	0.0	1	779	1	779
CAH07065.1	0.0	1	779	1	779
QCT77897.1	0.0	1	779	1	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	2.08e-35	53	555	146	668	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.28e-35	53	555	167	689	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	1.11e-32	53	555	150	672	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
2OQO_A	2.23e-31	79	252	26	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.67e-31	79	252	26	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	2.70e-105	54	779	44	770	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P45345	9.54e-42	53	579	147	702	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
Q9KUC0	1.25e-41	75	555	182	689	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P40750	3.59e-41	57	557	60	599	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
O66874	1.66e-40	48	595	40	684	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999978	0.000042	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001337_01832.