CAZyme Information: MGYG000001337_01115

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_01115
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000001337_2|CGC19	111748.56	8.2688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 716503; End: 719451 Strand: +

Full Sequence      

MRHLFLLAALFCACISYAQIRVQERLPKSKTGFALTTAKTRAKIYYDVNDALVIKRSAEL
FARDIQMVTGQKPELIPKRERAKALVIVGTIEKNQWICELAQKGKIDIRPLQGAWERYLI
QTVDNPSPGVAKALVIAGSDRRGAAYGLFSISEMMGVSPWYWWGDVPVKTHKALYVDAPP
TYSKTPSVKYRGIFLNDEDWGLKPWAAKTFEKERGNIGPRTYAKICELLLRLKANHLAPA
MHPVSTAFYQIPENKLVADTFAIVMGSSHCEPLLLNTASEWHSKTMGPWDYNANKDKINE
VLGNRVKENCAYENVYTLALRGLHDAAMGGGDVPMKEKVKMLENALKDQRSLLTRHIDKP
AETIPQAFTPYKEVLEIYSNGLELPDDVTIIWADDNFGYMKRLSGPQEQKRTGRAGVYYH
ISYLGVPHSYLWFSTTPPALMYEELRKAYDTTADRIWLANCGDLKGAEAQVSFFLDMAYD
IDQFNENNVHTYPARWLAKIFGEQYYDTLKDITCSHINLAFSRKPEYMGWGYWNNYWGGG
EKRTDTEFSFINYNEAGRRLAEYRRIGKKAEEMLATVDKKAKPALYQLLYYPVKGAELMN
RMNMTGQLYRQYVRQKRAAADDLKRETTTCHDSLEIITDGYNSLLDGKWKYMMSLRQNYD
GSSSYFMLPLMEESYVATGDPKLAVQVESEQLNRGGFSFRALPVFNTYSRKSHWIDVYNQ
GGGMLDWKSELSDEWIVLSRQSGSTRTEDRIQVSIDWNKVPSGEKVTGFIEFSSGMQKER
VLVSVFNPKTPVRDELQGLFIEENGYVSLPATAFHRKFESEDVKMSVLPGLGFEGAALQI
GSPIAPLQMYRSSEVPRVEYDFYTFNAGMVDVYTYVLPTFPLHADRDYKLPEHTNSDTKY
SVRIDDGSISTPSTSAIEYSQIWYDSVLKNCRVNKSTLYVKAPGKHTLQIRCGDPGTVIQ
KIVIDMGGLKRSYLGPETTLCR

Enzyme Prediction     

No EC number prediction in MGYG000001337_01115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	32	657	1.1e-226	0.8220946915351507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	3.84e-163	184	526	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.68e-57	800	977	2	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14948	BACON	0.001	726	784	27	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBW21176.1	0.0	1	982	1	982
QRP87508.1	0.0	1	982	1	982
QCQ40283.1	0.0	1	982	1	982
AKA50619.1	0.0	1	982	1	982
ANQ62807.1	0.0	1	982	1	982

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	4.90e-149	28	976	9	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	1.22e-125	49	649	35	611	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	1.09e-112	1	974	12	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	4.13e-102	35	979	13	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PUG_A	1.15e-99	33	701	17	664	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000896	0.995549	0.002965	0.000198	0.000190	0.000178

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001337_01115.