CAZyme Information: MGYG000001328_02932

Basic Information

• Species: Clostridium tertium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium tertium
• CAZyme ID: MGYG000001328_02932
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	MGYG000001328_3|CGC44	50151.67	10.0107

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001328	3807822	Isolate	not provided	not provided

• Gene Location: Start: 2771560; End: 2772852 Strand: -

Full Sequence      

MNKVKEKVLIISEVFYPEIGSGANRITNLVIELKKNGYMVDVVTSEPSYPNKDIYKEDGY
RDLEKENDIYTGSNIHRVRTSKVKRTTNFFIRLYIYINFFFKSIFSIIFRRSKYNLVIAT
IPSPFSGVLGIIAKIRFRCKFILDIRDLWPECIKNVGLFRKNKFLLKIAYVLEKVIFKFT
DSIVINSNGFKEYINKNKYKKRVVFIPNGLQVSEIERYEKIRRKTNKHRKFTVIYTGMIG
LPQNVTSLVRVARNLRHIEDIEFKIIGTGIQREKVLELIDHYDLKNIRVYNPMPKNKVVE
EVAKCHIGLAHLRKDSAFDLVIPGKIIDYMGIGIPIVAGVEGYAAKVINDSESGLVVEPD
DYVGLSKAIMKIYNDKKSYEYYSKNGMNYCLNNFCVENNLIKYIDLIERVTRRNDYVKKN
RDVCMESLHQ

Enzyme Prediction     

No EC number prediction in MGYG000001328_02932.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	224	380	2.4e-17	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	7.02e-86	7	398	1	385	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	1.77e-25	7	414	2	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	2.33e-22	7	408	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03817	GT4_UGDG-like	8.57e-18	7	389	1	355	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03823	GT4_ExpE7-like	4.44e-14	7	409	1	357	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQM59624.1	2.49e-147	12	429	2	418
QBJ65751.1	2.77e-91	6	430	2	413
QUW31565.1	2.77e-91	6	430	2	413
ADK07818.1	2.77e-91	6	430	2	413
QWG47498.1	2.19e-90	6	430	2	413

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
F4JLK2	2.77e-06	228	428	514	718	Sucrose-phosphate synthase 4 OS=Arabidopsis thaliana OX=3702 GN=SPS4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
89	108