CAZyme Information: MGYG000001316_01506

Basic Information

• Species: Mitsuokella multacida
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Mitsuokella; Mitsuokella multacida
• CAZyme ID: MGYG000001316_01506
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214	MGYG000001316_6|CGC4	24886.08	6.4999

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001316	2574556	Isolate	not provided	not provided

• Gene Location: Start: 487307; End: 487951 Strand: +

Full Sequence      

MKRPDFLERVAQARRTAHRKYLYAIASAVIFLAFAIYLTFASEAFQRHYLYPFPYRDTVE
TYSDRYRVDPYLAIAVIKTESKFQDGVHSHRGAIGLMQLMPDTAEWIAGQLEDPSYSIEA
IHEPERNIRYGIWYLSTLQHEFDGNDVLALAAYNAGRGNVQSWIREYGWPADFHDIDAIP
YKETREYVRKVLLTEHKYRSLYPEADGIGSGMKD

Enzyme Prediction     

No EC number prediction in MGYG000001316_01506.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	67	194	6.5e-31	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.65e-80	52	192	1	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.93e-59	50	201	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.03e-37	70	192	1	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.14e-33	7	204	84	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	9.25e-30	62	175	4	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83210.1	4.02e-76	6	204	4	203
SNV00064.1	1.45e-62	42	202	24	184
BDA10554.1	7.15e-61	29	202	2	175
QIB61241.1	4.09e-60	29	202	2	175
CBL05784.1	5.46e-60	29	202	11	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.51e-23	54	202	415	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.52e-23	54	202	419	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.53e-23	54	202	425	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.54e-23	54	202	429	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.55e-23	54	202	435	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	2.58e-19	51	199	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	2.58e-19	51	199	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	8.79e-19	51	210	476	637	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.92e-17	63	191	68	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	7.63e-17	55	197	1422	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40