CAZyme Information: MGYG000001315_02430

Basic Information

• Species: Bariatricus comes
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Bariatricus; Bariatricus comes
• CAZyme ID: MGYG000001315_02430
• CAZy Family: GT4
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001315_11|CGC1	45773.78	7.8607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001315	3238915	Isolate	not provided	not provided

• Gene Location: Start: 55541; End: 56740 Strand: -

Full Sequence      

MRVLIINKFLYPNGGSETYIFKLGEALEQHGHEVQYFGMEHEGRCVGNRVNAYTSDMDFH
GGSKLSKLTYPIKTIYSKEAREKLRLVLDDFKPDVCHLNNFNYQLTPSIILEIVKWRKET
GRDCKIIFTAHDYQLVCPNHMLNNPNAHQNCEKCLGGHFANCMKGKCIHGSTAKSAIGMM
EAEFWKWKGTYKYIDTMICCSEFMKSKMDSNPLFATKTVAMHNFIDKVEWKETPKKDYVL
YFGRFSEEKGIGTLIKVCKELQDVQFIFAGTGPLEETVNGIKNIKNVGFQKGEALEKLIR
EARFSIYPSEWYENCPFSVMESQMYGTPVLGANIGGIPELIQVGKTGELFESGNGKDLKR
KIEKLWGDKKLCAEYSANCKDISFDTIDEYYEKIMKVYR

Enzyme Prediction     

No EC number prediction in MGYG000001315_02430.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	231	374	1.8e-29	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	4.63e-48	2	399	1	356	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03801	GT4_PimA-like	2.93e-45	2	399	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.37e-34	1	399	1	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.94e-24	235	378	1	154	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	7.44e-23	2	392	1	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT49764.1	6.97e-310	1	399	1	399
QMW78049.1	2.19e-273	1	398	1	398
QIB53531.1	2.19e-273	1	398	1	398
QBE98775.1	1.47e-271	1	398	1	398
CBK90017.1	2.74e-269	1	399	2	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D00_A	8.02e-06	1	376	3	348	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48454	5.54e-14	1	343	1	328	Uncharacterized 42.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q8S4F6	6.74e-11	234	370	306	447	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
Q48453	5.86e-09	225	398	179	358	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q4H4F8	8.62e-08	236	354	205	333	2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Niallia circulans OX=1397 GN=btrM PE=3 SV=1
Q46638	6.62e-07	239	358	226	361	Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora OX=552 GN=amsK PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001315_02430.